KEGG   Homo sapiens (human): 1663Help
Entry
1663              CDS       T01001                                 

Gene name
DDX11, CHL1, CHLR1, KRG2, WABS
Definition
(RefSeq) DEAD/H-box helicase 11
  KO
K11273  chromosome transmission fidelity protein 1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Disease
H00914  Warsaw breakage syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1663 (DDX11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1663 (DDX11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    1663 (DDX11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD_2 Helicase_C_2 HBB ResIII AAA_22
Motif
Other DBs
NCBI-GeneID: 1663
NCBI-ProteinID: NP_001244073
OMIM: 601150
HGNC: 2736
Ensembl: ENSG00000013573
Vega: OTTHUMG00000168435
Pharos: Q96FC9(Tbio)
UniProt: Q96FC9
Position
12p11.21
AA seq 970 aa AA seqDB search
MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALS
WLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQK
KEERDLVDRLKAEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLET
GPEAERLEQLESGEEELVLAEYESDEEKKVASRVDEDEDDLEEEHITKIYYCSRTHSQLA
QFVHEVKKSPFGKDVRLVSLGSRQNLCVNEDVKSLGSVQLINDRCVDMQRSRHEKKKGAE
EEKPKRRRQEKQAACPFYNHEQMGLLRDEALAEVKDMEQLLALGKEARACPYYGSRLAIP
AAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDTITGMHSVEVSGSQLCQAHS
QLLQYVERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQTGTELKTIND
FLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPR
TTEALAAPADESQASTLRPASPLMHIQGFLAALTTANQDGRVILSRQGSLSQSTLKFLLL
NPAVHFAQVVKECRAVVIAGGTMQPVSDFRQQLLACAGVEAERVVEFSCGHVIPPDNILP
LVICSGISNQPLEFTFQKRELPQMMDEVGRILCNLCGVVPGGVVCFFPSYEYLRQVHAHW
EKGGLLGRLAARKKIFQEPKSAHQVEQVLLAYSRCIQACGQERGQVTGALLLSVVGGKMS
EGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEGRQ
PVHRQGHQAPEGFCQRSAPGPAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGE
VGLFLMGNHTTAWRRALPLSCPLETVFVVGVVCGDPVTKVKPRRRVWSPECCQDPGTGVS
SRRRKWGNPE
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgaaacacagaaggttggtgccatccattttccttttcccttcacaccctat
tccatccaggaagacttcatggcagagctgtaccgggttttggaggctggcaagattggg
atatttgagagtccaactggcactgggaagtccttaagtcttatttgtggggccctctct
tggctccgtgactttgaacagaagaagcgtgaagaagaggcacgactccttgaaactgga
actggccccttacatgatgagaaagatgaatccctgtgtctgtcttcttcctgcgaaggg
gctgcaggcaccccgaggcctgctggagaaccggcctgggttactcagtttgtgcagaag
aaagaagagagggacctggtggaccgactaaaggcggagcaggccaggaggaagcagcga
gaagaacgcctgcagcagctgcagcacagggtgcagctcaagtatgcagccaagcgcctg
aggcaggaagaagaagaaagagagaatctcctccgcctcagcagggagatgctagagaca
ggcccggaggctgagcggctggagcagctggagtctggggaggaggagctggtcctcgcc
gaatacgagagtgatgaggagaaaaaggtggcgagcagagtggatgaggatgaggatgac
ctggaggaagaacacataactaagatttattactgtagtcggacacactcccagctggcc
cagtttgtgcatgaggtgaagaagagcccctttggcaaggatgttcggctggtctccctt
ggctcccggcagaacctttgtgtaaatgaagacgtgaaaagcctaggttctgtgcagctt
atcaacgaccgctgtgtggacatgcagagaagcaggcacgagaagaagaaaggagctgag
gaggagaagccaaagaggaggaggcaggagaagcaggcagcctgccccttctacaaccac
gagcagatgggccttctccgggatgaggccctggcagaggtgaaggacatggagcagctg
ctggcccttgggaaggaggcccgggcctgtccctattacgggagccgccttgccatccct
gcagcccagctggtggtgctgccctatcagatgctgctgcatgcggccactcggcaggcc
gcgggcatccggctgcaggaccaggtggtgatcatcgacgaggcgcacaacctgatcgac
accatcacgggcatgcacagcgtggaggtcagcggctcccagctctgccaggcccattcc
cagctgctgcagtacgtggagcgatacgggaagcgtttgaaggccaagaacctgatgtac
ctgaagcagatcctgtatttgctggagaaattcgtggctgtgctaggggggaacattaag
caaaatcccaatacacagagtctgtcacagacagggacggagctgaagaccatcaacgac
tttctcttccagagccagatcgacaacatcaacctgttcaaggtgcagcgatactgtgag
aagagcatgatcagcagaaagctctttggattcactgaacggtacggagcagtgttctca
tcccgggagcagcccaaactggctgggtttcagcaattcctgcagagcctgcagcccagg
acgactgaagctcttgcagcccctgcagacgagagtcaggccagcaccctgcgaccagct
tctccactgatgcacatccaaggcttcctggcagctctcactacggccaaccaggacggc
agggtcatcctgagccgccaaggcagcctcagtcagagcaccctgaagtttttgctcctg
aatccagctgtgcactttgcccaagtggtgaaggaatgccgggcagtggtcattgcgggg
ggtaccatgcagccggtgtctgacttccggcagcagctgctggcctgtgccggggtggaa
gctgagcgcgtggtggagttttcctgtggtcacgtgatccctccagacaacatcctgccc
ctcgtcatctgcagcgggatctccaaccagccgctggaattcacgttccagaaaagagag
ctgcctcagatgatggacgaggtgggtcgcattctctgtaacctgtgcggtgtggttcct
ggaggggtggtctgtttcttcccctcctacgagtacctgcgccaggtccatgcccactgg
gagaagggtggcctgctgggccgtctggctgccaggaagaagatattccaggaacctaag
agcgcacaccaggtggagcaggtgctgctggcatattccaggtgcatccaggcctgtggc
caggagagaggccaggtgacaggggccctgctcctctctgtggttggaggaaagatgagt
gaagggatcaacttctctgacaacctaggccggtgtgtggtgatggtgggcatgcccttc
cccaacatcaggtctgcagagctgcaggagaagatggcctacttggatcaaaccctcagc
ccccggccaggcacccccagggaaggctctggtggagaacctgtgcatgaaggccgtcaa
ccagtccataggcagggccatcaggcaccagaaggattttgccagcgtagtgctcctgga
ccagcgatatgcccggccccctgtcctggccaagctgccggcctggatccgagcccgtgt
ggaggtcaaagctacctttggccccgccattgctgctgtgcagaagtttcaccgggagaa
gtcggcctcttcctgatgggcaaccacaccactgcctggcgccgtgcccttcctttgtcc
tgcccgctggagacagtgtttgtcgtgggcgtggtctgcggggatcctgttacaaaggtg
aaacccaggaggagagtgtggagtccagagtgctgccaggacccaggcacaggcgttagc
tcccgtaggagaaaatgggggaatcctgaatga

DBGET integrated database retrieval system