KEGG   Homo sapiens (human): 1665Help
Entry
1665              CDS       T01001                                 

Gene name
DHX15, DBP1, DDX15, HRH2, PRP43, PRPF43, PrPp43p
Definition
(RefSeq) DEAH-box helicase 15
  KO
K12820  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    1665 (DHX15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1665 (DHX15)
   03009 Ribosome biogenesis [BR:hsa03009]
    1665 (DHX15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1665 (DHX15)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    1665 (DHX15)
 Complex B
    1665 (DHX15)
 Complex C
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-SnRNP related factors
    1665 (DHX15)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Helicases
    1665 (DHX15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_19 AAA_22 SRP54 ResIII AAA_30 AAA_25 Flavi_DEAD AAA_29 Atrophin-1 DUF1777 HTH_IclR AAA_23
Motif
Other DBs
NCBI-GeneID: 1665
NCBI-ProteinID: NP_001349
OMIM: 603403
HGNC: 2738
Ensembl: ENSG00000109606
Vega: OTTHUMG00000160304
Pharos: O43143(Tbio)
UniProt: O43143
Structure
PDB: 

Position
4p15.2
AA seq 795 aa AA seqDB search
MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKE
LRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTN
LPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRS
LPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGM
LLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKF
QIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQE
EIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVS
TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGK
CFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRAL
ELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCF
VRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNV
RQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQ
LHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQL
DRIIAKLQSKEYSQY
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcggcaccggttggacctaggggaggattacccctctggcaagaagcgtgcg
gggaccgatgggaaggatcgagatcgagaccgggatcgtgaagatcggtctaaagatcga
gaccgagaacgtgatagaggagatagagagcgagagagggagaaagaaaaggagaaggag
ttgcgagcttcaacaaatgctatgcttatcagtgctggattaccacctttgaaagcttcc
cattcagctcactcaacccactcagcacattcaacgcattcaacacattctgctcattca
acgcatgccggacatgcaggtcacacgtcacttccacagtgcattaatccgttcaccaac
ttaccccatactcctcgatactatgatattctaaagaaacgtcttcagctccctgtttgg
gaatacaaggataggtttacagatattctggttagacatcagtcctttgtactggttggt
gagactgggtctggtaaaacaacacagattccacagtggtgtgtggagtacatgcgatca
ttaccaggacccaagagaggagttgcctgtacccaacccaggagagtggctgcaatgagt
gtggctcagagagttgctgatgagatggatgtgatgttgggccaggaagttggttactcc
attcgatttgaagactgcagtagtgcaaaaaccattcttaagtatatgactgatgggatg
ttacttcgtgaagctatgaatgatcccctcctggagcgttatggtgtaataattcttgat
gaggctcatgagaggacactggctacagatattctaatgggtgttctgaaggaagttgta
agacagagatcagatttaaaggttatagttatgagcgctactctagatgcaggaaaattc
cagatttactttgataactgtcctctcctaactattcctgggcgtacacatcctgttgag
atcttctatactccagaaccagagagagattatcttgaagcagcaattcgaacagttatc
cagattcatatgtgtgaagaggaagagggagatcttcttcttttcttaactggtcaagag
gaaattgatgaagcctgtaagagaataaagcgtgaagttgatgatttgggccctgaagtt
ggtgacattaaaatcattccattgtattctacacttccacctcagcagcagcaacgcatt
tttgagcctccacctcccaaaaaacagaatggagcaattggaagaaaggtagttgtgtca
actaacatagcagagacgtctttgacaatagatggtgtggtgtttgtgattgatcctgga
tttgcgaaacagaaggtctacaatcctcgaatcagagttgagtcccttttggtgacagct
attagtaaagcttcagctcagcaaagggctggtcgagctggacgtaccagacctggaaaa
tgcttcagactttacacagagaaagcttataaaacagaaatgcaggataacacctatcct
gagattttgcgttctaatttaggatcagttgtgttacaattgaagaaacttggtattgat
gacttggtacattttgattttatggatccaccagctcctgaaactctgatgagagccctg
gaacttttgaattacctggctgctttaaatgatgatggagatctgactgaattgggatcc
atgatggcagagtttcctctagatccacagctcgcaaaaatggttattgcaagttgtgac
tacaactgttctaatgaggtcctatctattactgctatgttgtcagtcccacagtgtttt
gttcgccccacggaggccaagaaagccgcagatgaggccaagatgagatttgcccacata
gatggagatcatctgacactgctgaacgtctaccatgcttttaaacaaaatcatgaatcg
gttcagtggtgttatgacaacttcattaactacaggtccctgatgtccgcagacaatgta
cgccagcagctatctcgaattatggacagatttaatttgcctcgtcgaagtactgacttt
acaagcagggactattatattaatataagaaaagctttggttactgggtattttatgcag
gtggcacatttagaacgaacagggcattacttaactgtgaaagataaccaggtggttcag
ttgcatccctctactgttcttgaccacaaacctgaatgggtgctttataatgagtttgtt
ctaacaacaaagaattacatccggacatgtacagatatcaagccagaatggttggtgaaa
attgcccctcaatattatgacatgagcaatttcccacagtgtgaagcaaagagacagttg
gaccgcatcattgccaaacttcaatccaaggaatattcacagtactga

DBGET integrated database retrieval system