KEGG   Homo sapiens (human): 166614Help
Entry
166614            CDS       T01001                                 

Gene name
DCLK2, CL2, CLICK-II, CLICK2, CLIK2, DCAMKL2, DCDC3, DCDC3B, DCK2
Definition
(RefSeq) doublecortin like kinase 2
  KO
K08805  doublecortin-like kinase 1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    166614 (DCLK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     166614 (DCLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DCAMKL family
   166614 (DCLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase DCX Pkinase_Tyr Kinase-like Kdo Metallothio_Pro
Motif
Other DBs
NCBI-GeneID: 166614
NCBI-ProteinID: NP_001035350
OMIM: 613166
HGNC: 19002
Ensembl: ENSG00000170390
Vega: OTTHUMG00000161444
Pharos: Q8N568(Tchem)
UniProt: Q8N568
Position
4q31.23-q31.3
AA seq 766 aa AA seqDB search
MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSSSGPKGNGLIPSPAHSAHCSFYRTR
TLQALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV
RTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNINPNWSVNIKGGTSRALAAA
SSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAIKLDSG
VVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQDDFVLDHSECRVLKSSYSRSSA
VKYSGSKSPGPSRRSKSPASVNGTPSSQLSTPKSTKSSSSSPTSPGSFRGLKQISAHGRS
SSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEF
ALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDA
ITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGL
ATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQED
LFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQENN
MQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEPISP
VPPSVEEIPVPGEAVPAPTPPESPTPHPPPAAPGGERAGTWRRHRD
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccaggagtatcgagctggagcactttgaggaacgggacaaaaggccgcgg
ccggggtcgcggagaggggcccccagctcctccgggggcagcagcagctcgggccccaag
gggaacgggctcatccccagtccggcgcacagtgcccactgcagcttctaccgcacgcgg
accctgcaggccctcagctcggagaagaaggccaagaaggcgcgcttctaccggaacggg
gaccgctacttcaagggcctggtgtttgccatctccagcgaccgcttccggtccttcgat
gcgctcctcatagagctcacccgctccctgtcggacaacgtgaacctgccccagggtgtc
cgcactatctacaccatcgacggcagccggaaggtcaccagcctggacgagctgctggaa
ggtgagagttacgtgtgtgcatccaatgaaccatttcgtaaagtcgattacaccaaaaat
attaatccaaactggtctgtgaacatcaagggtgggacatcccgagcgctggctgctgcc
tcctctgtgaaaagtgaagtaaaagaaagtaaagatttcatcaaacccaagttagtgact
gtgattcgaagtggagtgaagcctagaaaagccgtgcggatccttctgaataaaaagact
gctcattcctttgaacaagtcttaacagatatcaccgaagccattaaactagactcagga
gtcgtcaagaggctctgcaccctggatggaaagcaggttacttgtctgcaagactttttt
ggtgatgacgatgtttttattgcatgtggaccagaaaaatttcgttatgcccaagatgac
tttgtcctggatcatagtgaatgtcgtgtcctgaagtcatcttattctcgatcctcagct
gttaagtattctggatccaaaagccctgggccctctcgacgcagcaaatcaccagcttca
gttaatggaactcccagcagccaactttctactcctaaatctacgaaatcctccagttcc
tctccaactagtccaggaagtttcagaggattaaagcagatttctgctcatggcagatct
tcttccaatgtaaacggtggacctgagcttgaccgttgcataagtcctgaaggtgtgaat
ggaaacagatgctctgaatcatcaactcttcttgagaaatacaaaattggaaaggtcatt
ggtgatggcaattttgcagtagtcaaagagtgtatagacaggtccactggaaaggagttt
gccctaaagattatagacaaagccaaatgttgtggaaaggaacacctgattgagaatgaa
gtgtcaatactgcgccgagtgaaacatcccaatatcattatgctggtcgaggagatggaa
acagcaactgagctctttctggtgatggaattggtcaaaggtggagatctctttgatgca
attacttcgtcgaccaagtacactgagagagatggcagtgccatggtgtacaacttagcc
aatgccctcaggtatctccatggcctcagcatcgtgcacagagacatcaaaccagagaat
ctcttggtgtgtgaatatcctgatggaaccaagtctttgaaactgggagactttgggctt
gcgactgtggtagaaggccctttatacacagtctgtggcacacccacttatgtggctcca
gaaatcattgctgaaactggctatggcctgaaggtggacatttgggcagctggtgtgatc
acatacatacttctctgtggattcccaccattccgaagtgagaacaatctccaggaagat
ctcttcgaccagatcttggctgggaagctggagtttccggccccctactgggataacatc
acggactctgccaaggaattaatcagtcaaatgcttcaggtaaatgttgaagctcggtgt
accgcgggacaaatcctgagtcacccctgggtgtcagatgatgcctcccaggagaataac
atgcaagctgaggtgacaggtaaactaaaacagcactttaataatgcgctccccaaacag
aacagcactaccaccggggtctccgtcatcatgaacacggctctagataaggaggggcag
attttctgcagcaagcactgtcaagacagcggcaggcctgggatggagcccatctctcca
gttcctccctcagtggaggagatccctgtgcctggggaagcagtcccggcccccacccct
ccggaatctcccaccccccaccctcctcccgctgccccgggtggtgagcgggcaggaacc
tggcgccgccaccgagactga

DBGET integrated database retrieval system