KEGG   Homo sapiens (human): 166655Help
Entry
166655            CDS       T01001                                 

Gene name
TRIM60, RNF129, RNF33
Definition
(RefSeq) tripartite motif containing 60
  KO
K12029  tripartite motif-containing protein 60/61
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    166655 (TRIM60)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    166655 (TRIM60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 SPRY zf-C3HC4_2 zf-RING_2 zf-B_box zf-C3HC4_3 zf-RING_5 zf-RING_10 zf-Nse zf-rbx1 zf-RING_6
Motif
Other DBs
NCBI-GeneID: 166655
NCBI-ProteinID: NP_001244954
HGNC: 21162
Ensembl: ENSG00000176979
Vega: OTTHUMG00000161262
Pharos: Q495X7(Tdark)
UniProt: Q495X7
Position
4q32.3
AA seq 471 aa AA seqDB search
MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLSVSWKDLDDTFPCPVCRFCF
PYKSFRRNPQLRNLTEIAKQLQIRRSKRKRQKENAMCEKHNQFLTLFCVKDLEILCTQCS
FSTKHQKHYICPIKKAASYHREILEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKR
EEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGK
SVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILD
LNTAHPQLLVSEDRKAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKP
KWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtgacagccctggtgaacctccaagaggagtctagctgtcccatctgtctg
gagtacttgaaagacccagtgaccatcaactgtgggcacaacttctgtcgctcctgcctc
agtgtatcctggaaggatctagatgatacctttccctgtcctgtctgccgtttttgcttt
ccatacaagagcttcaggaggaacccccagctccgtaatttgactgaaattgctaaacaa
ctccagattaggaggagcaagagaaagaggcagaaagagaatgccatgtgtgaaaaacac
aaccagtttctgaccctcttctgtgttaaagatctagagatcttatgtacacagtgcagt
ttctccactaaacaccagaagcactacatttgccctattaagaaagctgcctcttatcac
agagaaattctagaaggtagccttgagcccttgaggaataatatagaacgagttgaaaaa
gtgataattctgcaaggcagcaaatcagtggagctgaaaaagaaggtagaatataagagg
gaagaaataaattctgagtttgagcaaataagattgtttttacagaatgaacaagagatg
attcttaggcagatacaagatgaagagatgaacattttagcaaaactaaatgaaaacctt
gtagaactttcagattatgtttccacattaaaacatctactgagggaggtagagggcaag
tctgtgcagtcaaacctggaattactgacacaagctaagagtatgcaccacaagtatcaa
aacctaaaatgccctgaactcttttcatttagattaacaaaatatggtttcagtcttcct
cctcaatattctggcttggacagaattatcaagccatttcaagtagatgtgattctagat
ctcaacacagcacatcctcaacttcttgtctctgaggatagaaaagctgtgcgatatgaa
agaaaaaaacgaaacatttgttatgacccaaggagattttatgtctgccctgctgtccta
ggctctcagagatttagttctggccgacattactgggaagtagaagtgggaaacaaacct
aaatggatattgggtgtgtgtcaagactgtcttcttaggaactggcaggatcagccatca
gttctgggcggattctgggcaattgggcgatacatgaagagtggttatgttgcgtcaggt
cctaagacaacccagcttctgccagtagtaaaacccagtaaaattggtatttttctggac
tatgaattgggtgatctttccttttataatatgaatgataggtctattctctatactttt
aacgattgtttcacagaagccgtttggccttatttctatactggaacagattccgaacct
cttaaaatctgctcagtatcagattctgaaagataa

DBGET integrated database retrieval system