KEGG   Homo sapiens (human): 166785Help
Entry
166785            CDS       T01001                                 

Gene name
MMAA, cblA
Definition
(RefSeq) metabolism of cobalamin associated A
  KO
K07588  LAO/AO transport system kinase [EC:2.7.-.-]
Organism
hsa  Homo sapiens (human)
Disease
H00174  Methylmalonic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    166785 (MMAA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     166785 (MMAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MeaB cobW ATP_bind_1 AAA_22 AAA_18 AAA_30 Thymidylate_kin ABC_tran NTPase_1 RNA_helicase AAA_24 AAA_33
Motif
Other DBs
NCBI-GeneID: 166785
NCBI-ProteinID: NP_758454
OMIM: 607481
HGNC: 18871
Ensembl: ENSG00000151611
Vega: OTTHUMG00000161369
Pharos: Q8IVH4(Tbio)
UniProt: Q8IVH4
Structure
PDB: 

Position
4q31.21
AA seq 418 aa AA seqDB search
MPMLLPHPHQHFLKGLLRAPFRCYHFIFHSSTHLGSGIPCAQPFNSLGLHCTKWMLLSDG
LKRKLCVQTTLKDHTEGLSDKEQRFVDKLYTGLIQGQRACLAEAITLVESTHSRKKELAQ
VLLQKVLLYHREQEQSNKGKPLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAVD
PSSCTSGGSLLGDKTRMTELSRDMNAYIRPSPTRGTLGGVTRTTNEAILLCEGAGYDIIL
IETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVAVTKSDGDLIVPAR
RIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLMLASGELTAKRR
KQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFLLKAFKSRD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgctgctaccacatcctcaccagcatttcctaaaaggccttttaagagcacct
ttccgatgttaccacttcatctttcactcaagtactcatctcggatcaggaatcccatgt
gctcagccgtttaattctcttggactccattgtacaaagtggatgctgctgtcagatggc
ttaaagagaaaattatgtgtacaaacaaccttaaaggaccacacagaaggactttctgat
aaagagcaaagatttgtggataaactttatactggtttaatccaagggcaaagggcctgt
ttagcagaggccataactcttgtagaatcaactcacagcaggaaaaaggagttagcccag
gtgcttcttcagaaagtattactttaccacagagaacaagaacaatcaaataaaggaaaa
ccactagcatttcgagtaggattgtctgggccccctggtgctggaaaatcaacatttata
gaatattttggaaaaatgcttactgagagagggcacaaattatctgtgctagctgtggac
ccttcttcttgtactagtggtggatcactcttaggtgataaaacccgaatgactgagtta
tcaagagatatgaatgcatacatcaggccatctcctactagaggaactttaggaggcgtg
acaaggaccacaaatgaagctattctgttgtgtgaaggagcgggatatgacataattctt
attgaaaccgttggtgtgggtcagtcggagtttgctgttgctgacatggttgacatgttt
gttttactactgccaccagcaggaggagatgagctgcagggtatcaaaaggggtataatc
gagatggcagatctggtagctgtaactaaatctgatggagacttgattgtgccagctcga
aggatacaagcggaatatgtgagtgcactgaaattactccgcaaacgttcacaagtctgg
aaaccaaaggtaattcgtatttctgcccgaagtggagaggggatctctgaaatgtgggat
aaaatgaaagatttccaggacctaatgcttgccagtggggagctgactgccaaacgacgg
aagcaacagaaagtttggatgtggaatctcattcaggaaagtgtgttagagcatttcagg
acccaccccacagtccgggaacagattccacttctggaacaaaaggttctcattggggcc
ctgtccccaggactagcagcagacttcttgttaaaagcttttaaaagcagagactaa

DBGET integrated database retrieval system