KEGG   Homo sapiens (human): 1668Help
Entry
1668              CDS       T01001                                 

Gene name
DEFA3, DEF3, HNP-3, HNP3, HP-3, HP3
Definition
(RefSeq) defensin alpha 3
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
hsa05202  Transcriptional misregulation in cancer
Network
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1668 (DEFA3)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    1668 (DEFA3)
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    1668 (DEFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_propep Defensin_1 DUF4733
Motif
Other DBs
NCBI-GeneID: 1668
NCBI-ProteinID: NP_005208
OMIM: 604522
HGNC: 2762
Ensembl: ENSG00000239839
Vega: OTTHUMG00000090381
Pharos: P59666(Tbio)
CPD: C16056
UniProt: P59666 Q6EZE9
Structure
PDB: 

Position
8p23.1
AA seq 94 aa AA seqDB search
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctcgccatccttgctgccattctcctggtggccctgcaggcccaggctgag
ccactccaggcaagagctgatgaggttgctgcagccccggagcagattgcagcggacatc
ccagaagtggttgtttcccttgcatgggacgaaagcttggctccaaagcatccaggctca
aggaaaaacatggactgctattgcagaataccagcgtgcattgcaggagaacgtcgctat
ggaacctgcatctaccagggaagactctgggcattctgctgctga

DBGET integrated database retrieval system