KEGG   Homo sapiens (human): 1669Help
Entry
1669              CDS       T01001                                 

Gene name
DEFA4, DEF4, HNP-4, HP-4, HP4
Definition
(RefSeq) defensin alpha 4
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1669 (DEFA4)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    1669 (DEFA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_propep Defensin_1
Motif
Other DBs
NCBI-GeneID: 1669
NCBI-ProteinID: NP_001916
OMIM: 601157
HGNC: 2763
Ensembl: ENSG00000164821
Vega: OTTHUMG00000090382
Pharos: P12838(Tbio)
CPD: C16057
UniProt: P12838
Structure
PDB: 

Position
8p23.1
AA seq 97 aa AA seqDB search
MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGST
RGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatcgccctcctcgctgctattctcttggtagccctccaggtccgggcaggc
ccactccaggcaagaggtgatgaggctccaggccaggagcagcgtgggccagaagaccag
gacatatctatttcctttgcatgggataaaagctctgctcttcaggtttcaggctcaaca
aggggcatggtctgctcttgcagattagtattctgccggcgaacagaacttcgtgttggg
aactgcctcattggtggtgtgagtttcacatactgctgcacgcgtgtcgattaa

DBGET integrated database retrieval system