KEGG   Homo sapiens (human): 1670Help
Entry
1670              CDS       T01001                                 

Gene name
DEFA5, DEF5, HD-5
Definition
(RefSeq) defensin alpha 5
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1670 (DEFA5)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    1670 (DEFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_propep Defensin_1
Motif
Other DBs
NCBI-GeneID: 1670
NCBI-ProteinID: NP_066290
OMIM: 600472
HGNC: 2764
Ensembl: ENSG00000164816
Vega: OTTHUMG00000090383
Pharos: Q01523(Tbio)
CPD: C16058
UniProt: Q01523
Structure
PDB: 

Position
8p23.1
AA seq 94 aa AA seqDB search
MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQ
ARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccatcgccatccttgctgccattctcctggtggccctgcaggcccaggctgag
tcactccaggaaagagctgatgaggctacaacccagaagcagtctggggaagacaaccag
gaccttgctatctcctttgcaggaaatggactctctgctcttagaacctcaggttctcag
gcaagagccacctgctattgccgaaccggccgttgtgctacccgtgagtccctctccggg
gtgtgtgaaatcagtggccgcctctacagactctgctgtcgctga

DBGET integrated database retrieval system