KEGG   Homo sapiens (human): 1671
Entry
1671              CDS       T01001                                 

Gene name
DEFA6, DEF6, HD-6
Definition
(RefSeq) defensin alpha 6
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
hsa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1671 (DEFA6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1671 (DEFA6)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    1671 (DEFA6)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 Defensin_RK-1 Defensin_beta_2
Other DBs
NCBI-GeneID: 1671
NCBI-ProteinID: NP_001917
OMIM: 600471
HGNC: 2765
Ensembl: ENSG00000164822
Vega: OTTHUMG00000149984
Pharos: Q01524(Tbio)
UniProt: Q01524
Structure
PDB: 
3QTE 1ZMQ

Position
8p23.1
AA seq 100 aa
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSS
LRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
NT seq 303 nt   +upstreamnt  +downstreamnt
atgagaaccctcaccatcctcactgctgttctcctcgtggccctccaggccaaggctgag
ccactccaagctgaggatgatccactgcaggcaaaagcttatgaggctgatgcccaggag
cagcgtggggcaaatgaccaggactttgccgtctcctttgcagaggatgcaagctcaagt
cttagagctttgggctcaacaagggctttcacttgccattgcagaaggtcctgttattca
acagaatattcctatgggacctgcactgtcatgggtattaaccacagattctgctgcctc
tga

DBGET integrated database retrieval system