KEGG   Homo sapiens (human): 1673
Entry
1673              CDS       T01001                                 

Gene name
DEFB4A, BD-2, DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1
Definition
(RefSeq) defensin beta 4A
  KO
K21100  beta-defensin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1673 (DEFB4A)
   04657 IL-17 signaling pathway
    1673 (DEFB4A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    1673 (DEFB4A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    1673 (DEFB4A)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   1673 (DEFB4A)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 1673
NCBI-ProteinID: NP_004933
OMIM: 602215
HGNC: 2767
Ensembl: ENSG00000171711
Vega: OTTHUMG00000129314
Pharos: O15263(Tbio)
CPD: C16060
UniProt: O15263
Structure
PDB: 
6CS9 1FQQ 1E4Q

Position
8p23.1
AA seq 64 aa
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC
CKKP
NT seq 195 nt   +upstreamnt  +downstreamnt
atgagggtcttgtatctcctcttctcgttcctcttcatattcctgatgcctcttccaggt
gtttttggtggtataggcgatcctgttacctgccttaagagtggagccatatgtcatcca
gtcttttgccctagaaggtataaacaaattggcacctgtggtctccctggaacaaaatgc
tgcaaaaagccatga

DBGET integrated database retrieval system