KEGG   Homo sapiens (human): 167359Help
Entry
167359            CDS       T01001                                 

Gene name
NIM1K, NIM1
Definition
(RefSeq) NIM1 serine/threonine protein kinase
  KO
K16310  serine/threonine-protein kinase NIM1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    167359 (NIM1K)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     167359 (NIM1K)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   167359 (NIM1K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 FlgM Kdo
Motif
Other DBs
NCBI-GeneID: 167359
NCBI-ProteinID: NP_699192
HGNC: 28646
Ensembl: ENSG00000177453
Vega: OTTHUMG00000131147
Pharos: Q8IY84(Tbio)
UniProt: Q8IY84
Position
5p12
AA seq 436 aa AA seqDB search
MTAVYMNGGGLVNPHYARWDRRDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEK
VVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSR
EISSMEKLHHPNIIRLYEVVETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQI
VSAVKHMHENQIIHRDLKAENVFYTSNTCVKVGDFGFSTVSKKGEMLNTFCGSPPYAAPE
LFRDEHYIGIYVDIWALGVLLYFMVTGTMPFRAETVAKLKKSILEGTYSVPPHVSEPCHR
LIRGVLQQIPTERYGIDCIMNDEWMQGVPYPTPLEPFQLDPKHLSETSTLKEEENEVKST
LEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGS
RVYRGIRHTSKFCSIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagtgtatatgaatggaggtggcctggtgaacccccactatgcccggtgggat
cggcgcgacagtgtagaaagtggctgtcagaccgagagtagcaaggagggtgaggaggga
cagccccgccagctgacgcccttcgagaaactgacacaggacatgtcccaggatgagaag
gtggtgagggagatcacgctggggaaacggataggcttctaccgaattcgaggggaaatc
ggaagtggaaacttctcccaagtgaagcttgggattcactccctaaccaaagaaaaggtg
gccattaagatcctggacaagaccaagttagaccagaaaacccagaggctactatcccga
gaaatctccagcatggaaaagctgcaccatcccaacatcatccgcctttacgaagtggtg
gagaccctatccaagctgcacttggtgatggagtatgcagggggtggggagctcttcgga
aaaattagcactgaggggaagctctctgaaccagaaagcaagctcatcttctcccagatt
gtgtctgccgtgaagcacatgcatgaaaaccaaattattcatagagatctgaaagcagaa
aatgtattctataccagtaatacttgtgtgaaggtgggcgattttggattcagcacagta
agcaaaaaaggtgaaatgctgaacactttctgtgggtctcctccctacgctgcgcctgaa
ctcttccgggacgagcactacatcggcatttacgtggatatctgggccttgggggtgctt
ttgtacttcatggtgactggcaccatgccatttcgggcagaaaccgtggccaaactaaaa
aagagcatcctcgagggcacatacagtgtaccgccgcacgtgtcagagccctgccaccga
ctcatccgaggagtccttcagcagatccccacggagaggtacggaatcgactgcatcatg
aatgatgaatggatgcaaggggtgccataccctacacctttggaacctttccaactggat
cccaaacatttgtcggaaaccagcactctcaaggaagaagaaaatgaggtcaaaagcact
ttagaacatttgggcattacagaagagcatattcgaaataaccaagggagagatgctcgc
agctcaatcacaggggtctatagaattattttacatagagtccaaaggaagaaggctttg
gaaagtgtcccagtcatgatgctaccagaccctaaagaaagagacctcaaaaaagggtcc
cgtgtctacagagggataagacacacatccaaattttgctcgattttataa

DBGET integrated database retrieval system