KEGG   Homo sapiens (human): 1676Help
Entry
1676              CDS       T01001                                 

Gene name
DFFA, DFF-45, DFF1, ICAD
Definition
(RefSeq) DNA fragmentation factor subunit alpha
  KO
K02310  DNA fragmentation factor, 45 kD, alpha subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1676 (DFFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFF-C CIDE-N Yuri_gagarin COG2
Motif
Other DBs
NCBI-GeneID: 1676
NCBI-ProteinID: NP_004392
OMIM: 601882
HGNC: 2772
Ensembl: ENSG00000160049
Vega: OTTHUMG00000001909
Pharos: O00273(Tbio)
UniProt: O00273
Structure
PDB: 

Position
1p36.22
AA seq 331 aa AA seqDB search
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaccggggacgccggggtaccagaatctggcgagatccggactctaaagccg
tgtctgctgcgccgcaactacagccgcgaacagcacggcgtggccgcctcctgcctcgaa
gacctgaggagcaaggcctgtgacattctggccattgataagtccctgacaccagtcacc
ctggtcctggcagaggatggcaccatagtggatgatgacgattactttctgtgtctacct
tccaatactaagtttgtggcattggctagtaatgagaaatgggcatacaacaattcagat
ggaggtacagcttggatttcccaagagtcctttgatgtagatgaaacagacagcggggca
gggttgaagtggaagaatgtggccaggcagctgaaagaagatctgtccagcatcatcctc
ctatcagaggaggacctccagatgcttgttgacgctccctgctcagacctggctcaggaa
ctacgtcagagttgtgccaccgtccagcggctgcagcacacactccaacaggtgcttgac
caaagagaggaagtgcgtcagtccaagcagctcctgcagctgtacctccaggctttggag
aaagagggcagcctcttgtcaaagcaggaagagtccaaagctgcctttggtgaggaggtg
gatgcagtagacacgggtatcagcagagagacctcctcggacgttgcgctggcgagccac
atccttactgcactgagggagaagcaggctccagagctgagcttatctagtcaggatttg
gagttggttaccaaggaagaccccaaagcactggctgttgccttgaactgggacataaag
aagacggagactgttcaggaggcctgtgagcgggagctcgccctgcgcctgcagcagacg
cagagcttgcattctctccggagcatctcagcaagcaaggcctcaccacctggtgacctg
cagaatcctaagcgagccagacaggatcccacatag

DBGET integrated database retrieval system