KEGG   Homo sapiens (human): 167826
Entry
167826            CDS       T01001                                 
Symbol
OLIG3, Bhlhb7, bHLHe20
Name
(RefSeq) oligodendrocyte transcription factor 3
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    167826 (OLIG3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    167826 (OLIG3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 167826
NCBI-ProteinID: NP_786923
OMIM: 609323
HGNC: 18003
Ensembl: ENSG00000177468
Pharos: Q7RTU3(Tbio)
UniProt: Q7RTU3
Position
6:complement(137492199..137494394)
AA seq 272 aa
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaattctgattcgagctctgtctccagcagagcttcatctccggacatggatgagatg
tacctgagggaccaccaccaccgccaccaccaccaccaggagagccgtctcaactcggtc
tcgtccacgcagggcgatatgatgcagaagatgcccggggaaagcctctcgcgggctggc
gccaaggccgcgggagagagcagcaagtacaaaatcaagaagcagctgtcggagcaggac
ctacagcagttgaggctgaagatcaacggacgcgaacgcaagcggatgcacgacctgaac
ctagccatggacgggctgcgcgaagtcatgccctacgcgcatgggccgtcggtgcgcaag
ctctccaagatcgccacactcctgctcgccagaaactacatcctcatgctcaccagctcc
ctggaggagatgaagaggctggttggcgagatctatgggggccaccactcggcctttcac
tgcgggaccgtgggccactcggccggccaccccgcgcacgcggccaactccgtgcacccg
gtgcaccccatcttgggcggcgcgctctcatctggcaacgcctcgtcaccgctgtccgcc
gcctcacttcccgccatcggcaccatccggcctccccactcgctactcaaggcgccctcc
acgccgcccgcgctgcagctgggcagcggcttccagcactgggctggtctgccctgcccc
tgcaccatctgccagatgccgccgccgccgcacctgtccgctctctccacagccaacatg
gcccggctgtcggccgagtccaaggacttgctcaagtga

DBGET integrated database retrieval system