KEGG   Homo sapiens (human): 168002
Entry
168002            CDS       T01001                                 

Gene name
DACT2, C6orf116, DAPPER2, DPR2, bA503C24.7
Definition
(RefSeq) dishevelled binding antagonist of beta catenin 2
  KO
K22154  dapper
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    168002 (DACT2)
SSDB
Motif
Pfam: Dapper
Other DBs
NCBI-GeneID: 168002
NCBI-ProteinID: NP_999627
OMIM: 608966
HGNC: 21231
Ensembl: ENSG00000164488
Vega: OTTHUMG00000016046
Pharos: Q5SW24(Tbio)
UniProt: Q5SW24
Position
6q27
AA seq 774 aa
MWTPGGPPGSAGWDRRRLGARLRAAFAGLQELQGLRATQQERVRGALALQPPPAPAAPCG
PHGLHGPEQQLEAALAALQEQLSRLRQQDIGLKTHLDQLDLQISKLQLDVGTASGEALDS
DSRPSSGFYEMSDGGSCSLSTSCASVCSDHISPSLGSLLPVAQAHKARPSMGDWRPRSVD
ETTVPAWRPQATEEGARPPGSVEDAGQPWGTFWPRPVSTGDLDRALPADTGLQKASADAE
LLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLHAVALQSPLFVLTKETPQRGG
PSFPRESPRGPAGLNTIQTGPVLEAGPARARAYIDRLLHLWGRETPAKGSEGEQGPLRHA
ASPSPQRQGGWSTDGGGRLLVFAPGREDEGGPAQSRGAGRGGPQQQGYMPLEGPQQSGSL
PEEGSKPSNSCVLRETMVQASPSSKAQQTPSAQDYGRGNIISPSRMLDKSPSPASGHFAH
PSFAASLKMGPPKSKAEKIKRSPMDKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWP
TGRGGLQRRPALAWEAPGRSCSESTLYPMPVLVPLAVAPQESHRTSAQALFPFEASLLTS
VARRKHRRWQSTVEISARARLASCPESNLGPPRPVARRAGGPLARGRPSLVRQDAYTRSD
SEPSKHSAECDPRFPSVIPETSEGESSDHTTNRFGDRESSSSDEEGGAQSRDCDLALGYV
AAGHAELAWTQEAPVSSGPLLSPVPKLCRIKASKALKKKIRRFQPTALKVMTMV
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgtggacgccgggcggacccccggggtccgcgggctgggaccgccgtaggttgggcgcg
aggttgcgcgcggcgttcgcggggctgcaggagctgcaggggctgcgagccacgcagcag
gagcgggtacggggcgccctggccctgcagcccccgcccgcgcccgccgcgccctgcggc
ccccacggcctccacggccccgagcagcagctggaggcggcgctggccgcgctgcaggag
cagctgtcccggctgagacaacaggacatcggcctgaagacccacctggaccagctggac
ctgcagattagcaagctgcagctggatgtgggcacagcctcaggggaggccctggacagc
gacagcaggcccagctcaggcttttacgagatgagcgacggtggatcctgctccctgtcc
acgtcctgtgcctccgtctgcagtgaccacatctctccctcgctgggcagtttgttgcct
gtggcccaggcccacaaggccaggcccagcatgggggactggaggccccggtcggttgat
gagactactgtgccagcgtggagaccccaggctaccgaggagggcgccaggcccccaggg
agcgtggaggatgcaggccagccgtggggcacattctggcccaggcctgtgtctacaggt
gatcttgacagagccctgccggcggacacggggctccagaaagccagcgcggacgccgag
ctcctcgggctcctctgccagggggtggatatcccgctgcacgtgccggaccccaagtat
cggcaggacctggtgtcccagggcggcagggaggtgtacccgtaccccagccccctgcac
gccgtggctctacagagccccctgtttgtcctgactaaggaaaccccacagagaggtggc
ccctcgttccctagggagagccccaggggccccgcaggtctgaacaccatccagactggg
ccggtcctcgaggctggcccggccagggccagagcttatatcgacaggttgctgcatctg
tggggccgggagaccccagcaaagggtagcgagggagaacagggacctctaaggcatgca
gcgtccccatctccacagaggcagggtggctggagtacagacggtggagggcgactgctg
gtcttcgccccagggagggaggacgagggagggccagctcagagcaggggtgccggcagg
ggcgggccccagcagcagggatacatgccccttgagggtccccagcagtctggcagcctt
ccagaggagggctccaagccctcaaacagctgtgtcctcagggagaccatggtgcaggct
tctcccagctcaaaggcccagcagacaccctcagctcaggactatggacgaggcaacatc
atatccccatccaggatgctggacaagagcccctcaccggcctctgggcactttgcccac
ccatcctttgctgccagcctgaaaatgggtccccccaagagcaaggctgaaaaaatcaag
agaagtcccatggacaaggtgctgaggtttgcaaggcagccgctgcttctactggacagg
cctgagggagcccatgcagccccccagccatccctggagtgggaccctgcccactggccc
acagggaggggcgggctccagcggaggccagccctggcctgggaggcacccgggcgctcc
tgttctgagtccaccctctaccccatgcctgtcctcgtccccttggcagtggccccgcag
gagagccaccggacctcagcccaagccctgttcccctttgaggcgtcactgctcacctca
gtggccaggaggaagcatcgccgctggcagtccaccgtggagatctcggcccgggcccgc
ctggccagctgtcctgagtctaacctggggccccccaggcccgtggccaggagagcaggt
ggcccactggcccggggccgtccctcactggtccgccaggacgcctacaccaggagcgac
tcagagccctccaagcactcggccgagtgtgacccgcggttcccgtcagtcatcccggag
accagcgagggagagtccagtgaccacaccaccaaccgattcggagaccgtgagtccagc
agcagcgacgaggagggcggcgcccagagcagggactgtgacctggcactgggctatgtg
gcggccgggcatgcggagctggcctggacccaggaggccccggtcagctcggggccactc
ctgtcccccgtgcccaagctgtgccgtattaaggcctccaaggccctgaagaagaagatc
cgcaggttccagccgacggccctgaaggtcatgaccatggtgtga

DBGET integrated database retrieval system