KEGG   Homo sapiens (human): 168090
Entry
168090            CDS       T01001                                 
Symbol
C6orf118, bA85G2.1, dJ416F21.2
Name
(RefSeq) chromosome 6 open reading frame 118
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TSNAXIP1_N bZIP_2 Shugoshin_N
Other DBs
NCBI-GeneID: 168090
NCBI-ProteinID: NP_659417
HGNC: 21233
Ensembl: ENSG00000112539
Pharos: Q5T5N4(Tdark)
UniProt: Q5T5N4
Position
6:complement(165279664..165309605)
AA seq 469 aa
MAEEREPELYLKWKHCETPGVKTLCNLKHCETPGVKTLCNLKKLLNRLQKDHREDVYLYI
SGHLNPNKLYQPPETILQHWPNAHRPKGERASEVGEPPAGKVARMKEALAHFTIHTALVP
SEAQDTPLFRYLNPQASLSHTSEEDFLPVEAVREGKEEKKGGPPGRGPPGWRRREELRLP
DLKVLCYQEAGSRGTRDRHHYVSSYLAGATSADRYRMFLRFQKEVLAKQDLLKNDFTGSK
AAAGHERKLQQELQKICTCSPQQFNRLHVFGKVFEDICNSSLIFGDLLKKVKDEYELYMA
TLLESQPAAQYEALLAQLKALGQRPVKTADMDLAREELRMLVTATKAALEQNDRLRSELE
MEVALLQSAKERSESSEKHIIDENRLTLTEKVEKKRCEILSKWDEIQALEKEIKTTLVHT
GISDITENRIKSIEHEAIQLETENMILKKKIKGPLEIYQGICKIRGNRR
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcggaggagcgggagcctgaattgtacctgaagtggaagcactgcgagacgccaggc
gtgaagaccctgtgtaatctgaagcactgcgagacgccaggagtgaagaccctgtgtaat
ctgaagaaacttctgaatcggcttcagaaagaccaccgggaggacgtctacctctacatc
tctggacacctgaaccccaacaagctctaccagcctccggagacgatcttacagcactgg
cccaatgcccaccggcccaagggggagcgcgcctctgaggtgggagagccgcccgcaggg
aaggtggcgaggatgaaggaggccctggcccacttcaccatccacacggccctggtcccc
agtgaggcccaggacaccccgctgttcaggtacctgaacccccaggcctctctttcccac
acttcagaggaggatttccttccagtggaggctgtcagagaggggaaggaagaaaagaaa
ggaggccctcctggacggggccctcctggatggcgcaggagggaagaactccggctgccc
gacttgaaggtgctgtgctaccaggaggccgggtccagaggcaccagggaccggcaccac
tatgtcagctcctacctggccggagccaccagcgcagacaggtacaggatgttcctgcgt
ttccagaaggaagtgctcgccaagcaagatctcctgaagaatgacttcactgggagcaag
gcggccgcgggccacgagagaaagctgcagcaggagctccagaaaatttgcacgtgcagc
ccccagcagttcaacagactgcacgtctttggaaaagtctttgaagatatttgtaacagt
tctttgatatttggtgatctcttgaaaaaagttaaggatgaatatgaactctacatggca
acgctcctggagtcccagcctgcagcacagtacgaggctcttctggctcaactcaaggcg
ctggggcagaggccggtgaagacggcggacatggatctcgccagggaagagctgaggatg
ctcgtgacagccacaaaagcagccctggagcagaatgatagactcagaagtgaactggag
atggaggtggcattgctgcagtctgcaaaggaacgatcagaatcatctgagaaacatata
attgatgaaaaccgacttactcttactgagaaggttgaaaagaagaggtgtgaaatactc
agtaagtgggatgagatacaagctctggaaaaagaaattaaaacaactttggttcatact
ggaatttcagatatcactgagaataggattaaaagcatagagcatgaagctatacaattg
gaaacagaaaatatgattttaaagaagaaaataaaagggcctttggaaatttatcaagga
atttgtaaaatcagaggaaacagaagataa

DBGET integrated database retrieval system