KEGG   Homo sapiens (human): 1687
Entry
1687              CDS       T01001                                 
Symbol
GSDME, DFNA5, ICERE-1
Name
(RefSeq) gasdermin E
  KO
K22146  non-syndromic hearing impairment protein 5
Organism
hsa  Homo sapiens (human)
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    1687 (GSDME)
SSDB
Motif
Pfam: Gasdermin Gasdermin_C
Other DBs
NCBI-GeneID: 1687
NCBI-ProteinID: NP_001120925
OMIM: 608798
HGNC: 2810
Ensembl: ENSG00000105928
Pharos: O60443(Tbio)
UniProt: O60443 A0A024RA58
Position
7:complement(24698355..24795539)
AA seq 496 aa
MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGD
VLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRK
QEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKC
GGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGK
QGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA
ELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFL
QLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLL
RALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSVKAVILKDSKVFPLL
LCITLNGLCALGREHS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgtttgccaaagcaaccaggaattttcttagagaagttgatgctgatggtgacctgatt
gcagtatcaaatctgaatgactctgataagttacagcttctaagtctggtgacaaaaaag
aagagattctggtgctggcagagacccaagtaccagtttttatccctcacccttggcgat
gtactcatagaagaccaatttccgagtccagtggtcgtggagtcggactttgtgaaatac
gagggcaagtttgcaaaccacgtgagtggaaccctggagactgcactggggaaggtcaag
ctgaacctggggggcagcagccgcgtagagagccagtcttcatttggaaccctgaggaag
caggaggtggatttgcagcagctcatcagagactctgccgagagaacaataaatctgaga
aaccctgtgctccagcaggtgctggaaggaaggaatgaggtcctgtgcgttttgacacag
aagatcacgacgatgcagaagtgtgtgatctctgagcacatgcaggtcgaggagaagtgt
ggtggcatcgtgggcatccagaccaagacggtgcaggtgtcagcgacggaggatgggaat
gtcaccaaggactccaacgtggtgctggagatcccagctgccaccaccattgcctacggt
gtcattgagttatacgtgaaactggacggccagttcgagttctgccttctccgagggaag
caaggtggcttcgagaacaagaagagaattgactctgtctacctggaccccctggtcttt
cgagagtttgcattcatagacatgccagatgctgcgcatgggatatcttcccaggatgga
ccattaagtgttttaaagcaagcgaccctgctcctggagaggaatttccatccatttgcg
gagctgcctgagccacaacagacagctttgagtgacatcttccaggcggtcctatttgat
gatgaactactcatggtcctggaaccagtgtgcgatgacctggtcagcggcctctcgccc
acagtggcggtgctgggggagctgaagccccggcagcagcaggaccttgtggccttcctg
cagctggtggggtgcagcttacagggtgggtgtccgggccccgaggatgcaggcagcaag
cagctgtttatgacagcctacttcttggtcagtgccctcgcagaaatgccagatagcgca
gcagctctgctgggcacttgctgcaaactccagatcattcccacactgtgccacttgctt
cgtgctctgtctgatgatggagtatctgatcttgaagacccaaccttgactcccctgaaa
gatacagaaaggtttgggattgtgcagcgcttgtttgcctcagctgacattagtctggag
agactgaagtcatctgtgaaagctgtcattctgaaggactctaaagtcttcccactgctt
ctttgtataaccctgaatggactctgtgctttaggcagagaacattcatga

DBGET integrated database retrieval system