KEGG   Homo sapiens (human): 169026Help
Entry
169026            CDS       T01001                                 

Gene name
SLC30A8, ZNT8, ZnT-8
Definition
(RefSeq) solute carrier family 30 member 8
  KO
K14695  solute carrier family 30 (zinc transporter), member 8
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    169026 (SLC30A8)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC30: Zinc efflux transporter
   169026 (SLC30A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_efflux Ig_5
Motif
Other DBs
NCBI-GeneID: 169026
NCBI-ProteinID: NP_776250
OMIM: 611145
HGNC: 20303
Ensembl: ENSG00000164756
Vega: OTTHUMG00000164962
Pharos: Q8IWU4(Tbio)
UniProt: Q8IWU4
Position
8q24.11
AA seq 369 aa AA seqDB search
MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPT
EKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFS
LWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMII
VSSCAVAANIVLTVVLHQRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYF
KPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSV
HSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPD
CLFCEDPCD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggagtttcttgaaagaacgtatcttgtgaatgataaagctgccaagatgtatgctttc
acactagaaagtgtggaactccaacagaaaccggtgaataaagatcagtgtcccagagag
agaccagaggagctggagtcaggaggcatgtaccactgccacagtggctccaagcccaca
gaaaagggggcgaatgagtacgcctatgccaagtggaaactctgttctgcttcagcaata
tgcttcattttcatgattgcagaggtcgtgggtgggcacattgctgggagtcttgctgtt
gtcacagatgctgcccacctcttaattgacctgaccagtttcctgctcagtctcttctcc
ctgtggttgtcatcgaagcctccctctaagcggctgacatttggatggcaccgagcagag
atccttggtgccctgctctccatcctgtgcatctgggtggtgactggcgtgctagtgtac
ctggcatgtgagcgcctgctgtatcctgattaccagatccaggcgactgtgatgatcatc
gtttccagctgcgcagtggcggccaacattgtactaactgtggttttgcaccagagatgc
cttggccacaatcacaaggaagtacaagccaatgccagcgtcagagctgcttttgtgcat
gcccttggagatctatttcagagtatcagtgtgctaattagtgcacttattatctacttt
aagccagagtataaaatagccgacccaatctgcacattcatcttttccatcctggtcttg
gccagcaccatcactatcttaaaggacttctccatcttactcatggaaggtgtgccaaag
agcctgaattacagtggtgtgaaagagcttattttagcagtcgacggggtgctgtctgtg
cacagcctgcacatctggtctctaacaatgaatcaagtaattctctcagctcatgttgct
acagcagccagccgggacagccaagtggttcggagagaaattgctaaagcccttagcaaa
agctttacgatgcactcactcaccattcagatggaatctccagttgaccaggaccccgac
tgccttttctgtgaagacccctgtgactag

DBGET integrated database retrieval system