KEGG   Homo sapiens (human): 169270Help
Entry
169270            CDS       T01001                                 

Gene name
ZNF596
Definition
(RefSeq) zinc finger protein 596
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    169270 (ZNF596)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    169270 (ZNF596)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    169270 (ZNF596)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 GAGA Zn-ribbon_8 Ta0938 zf-C2H2_11 zf-met Zn-C2H2_12
Motif
Other DBs
NCBI-GeneID: 169270
NCBI-ProteinID: NP_001035880
HGNC: 27268
Ensembl: ENSG00000172748
Vega: OTTHUMG00000086931
Pharos: Q8TC21(Tdark)
UniProt: Q8TC21
Position
8p23.3
AA seq 504 aa AA seqDB search
MPSPDSMTFEDIIVDFTQEEWALLDTSQRKLFQDVMLENISHLVSIGKQLCKSVVLSQLE
QVEKLSTQRISLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDPFLCNDLGEDF
TQHIALTQNVITYMRTKHFVSKKFGKIFSDWLSFNQHKEIHTKCKSYGSHLFDYAFIQNS
ALRPHSVTHTREITLECRVCGKTFSKNSNLRRHEMIHTGEKPHGCHLCGKAFTHCSDLRK
HERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSDLRKHERT
HLGDKPYGCLLCGKAFSKCSYLRQHERTHNGEKPYECHLCGKAFSHCSHLRQHERSHNGE
KPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKAFTESSDLRRHERTHTGEKPYE
CHLCGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEKPYVCPLC
GKAFSKFFNLRQHERTHTKKAMNM
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaccggattccatgaccttcgaggatatcattgtagacttcactcaagaagag
tgggccctgctggacacatcccagagaaagctgtttcaagatgtgatgttggagaacatc
agtcatctggtctctattggcaaacagctctgcaaatcagttgtgctttcccaattggag
caagtagagaaactttcaacacaaagaataagcttactgcaaggtagagaagttggcatt
aaacatcaagagataccattcattcaacatatctatcagaagggcacgtccaccatcagc
acaatgagatctcatactcaagaggatccttttctatgcaatgacttaggagaagatttc
actcaacatatagcattgactcaaaatgtgattacctacatgagaacgaaacactttgta
agcaaaaagtttgggaaaatcttcagtgactggttatcctttaatcaacacaaggaaatt
cacaccaaatgtaaatcatatggaagtcatctatttgattatgcctttatccaaaactct
gcccttagaccacacagtgtgactcacactagagagataacattggaatgtcgtgtgtgt
gggaaaacctttagcaaaaattctaatcttaggcgacatgagatgattcacactggagag
aaaccacacggatgtcatctatgtgggaaagcctttactcattgctctgatcttcgaaaa
catgagagaactcacactggagagaagccatatggatgtcatctatgtgggaaagccttc
agtaaaagttctaaccttagacgacatgagatgattcacactagagaaaaagcacagata
tgccatctatgtgggaaagccttcactcattgctctgaccttagaaaacatgagagaact
cacttaggagataaaccatatggatgtctcctatgtgggaaggctttcagtaaatgttct
taccttagacaacatgaaagaactcacaatggagagaaaccatatgaatgtcatctatgt
ggaaaagccttctctcattgttctcaccttagacaacatgagcgaagtcacaatggagag
aaaccacatggatgtcatctatgtgggaaagcattcactgaatcttctgtgcttaaacga
catgagagaattcacactggagagaaaccatatgagtgccatgtatgtgggaaagccttc
actgaatcttctgacctcagacgacatgagagaactcacactggagaaaaaccatatgaa
tgccatctatgcggaaaagccttcaatcactcttctgtccttagacgacatgagagaact
cacactggagagaaaccatatgaatgcaatatatgtggtaaagccttcaatagaagttac
aactttagacttcatagaagagttcacactggagagaaaccatatgtatgtcctctatgt
gggaaagcctttagtaaattttttaaccttagacaacatgagagaactcacactaaaaaa
gcaatgaatatgtaa

DBGET integrated database retrieval system