KEGG   Homo sapiens (human): 169966
Entry
169966            CDS       T01001                                 
Symbol
TENT5D, CT1.26, CT112, FAM46D
Name
(RefSeq) terminal nucleotidyltransferase 5D
  KO
K23035  terminal nucleotidyltransferase 5D [EC:2.7.7.19]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    169966 (TENT5D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     169966 (TENT5D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    169966 (TENT5D)
SSDB
Motif
Pfam: NTP_transf_7
Other DBs
NCBI-GeneID: 169966
NCBI-ProteinID: NP_001164045
OMIM: 300976
HGNC: 28399
Ensembl: ENSG00000174016
Pharos: Q8NEK8(Tbio)
UniProt: Q8NEK8
Position
X:80335504..80445309
AA seq 389 aa
MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKD
ARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEK
LSPDIMKDAYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVL
DPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYC
SLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLM
TLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEAR
YPIYVIPEPPPVSFQPYHPLHFRGSNGMS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtctgaaatcagattcaccaatctcacttgggatcaagttataacactggatcaagtg
ttagatgaagtaattccaattcatggaaaggggaatttccccacaatggaggtaaaacca
aaagacatcattcatgttgtgaaagatcaactcatagggcaaggaattattgttaaagat
gccagattgaatggttccgtagcaagttacatacttgcaagccacaatggaatcagctat
aaggatctggacgttatttttggtgttgagcttccaggtaacgaagaatttcaggttgtt
aaagatgcagttctagactgtctacttgactttttaccaaaagatgtaaagaaggaaaag
ctctccccagatatcatgaaagacgcttacgtacagaaattggtcaaggtttgcaatggg
catgattgttggagtcttatctccctttcaaataacactgggaagaatttagaactaaaa
tttgtgagttcactcagacggcagtttgaatttagtgtagattcctttcaaattgttttg
gatcccatgttagacttctacagtgacaaaaatgccaagctaaccaaagaatcctatcct
gttgtggtagctgaaagcatgtatggagacttccaggaagcaatgacacatttgcaacac
aagctcatatgtaccaggaaacctgaagagattagaggtggtggccttctgaagtactgc
agcttgctggttcatggcttcaagccagcctgtatgtcagaaatcaaaaacctagaacgt
tatatgtgctctagattctttattgattttcctcatatagaagaacagcaaaagaaaatt
gaatcatacctccacaaccatttcataggtgaaggaatgaccaagtatgactaccttatg
accttgcatggagttgtgaatgaaagcactgtttgcctcatgagttatgaaagaagacag
attctccacctgatcaccatgatggctttgaaagtacttggagaactaaatattctaccc
aatacacaaaaggtaacttgcttttatcagcctgctccgtactttgcagctgaggcaagg
taccctatttatgtaatacctgagccaccccccgttagcttccagccataccacccactg
cactttcgtggatcaaatggtatgagttaa

DBGET integrated database retrieval system