KEGG   Homo sapiens (human): 170394
Entry
170394            CDS       T01001                                 
Symbol
PWWP2B, PWWP2, bA432J24.1, pp8607
Name
(RefSeq) PWWP domain containing 2B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PWWP
Other DBs
NCBI-GeneID: 170394
NCBI-ProteinID: NP_612508
HGNC: 25150
Ensembl: ENSG00000171813
Vega: OTTHUMG00000019286
Pharos: Q6NUJ5(Tdark)
UniProt: Q6NUJ5
Structure
Position
10:132397200..132417859
AA seq 590 aa
MEPRAGCRLPVRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDES
PVNDSHGRAPEEGDAEVMQLGSSSPPPARGVQPPETTRPEPPPPLVPPLPAGSLPPYPPY
FEGAPFPHPLWLRDTYKLWVPQPPPRTIKRTRRRLSRNRDPGRLILSTIRLRPRQVLCEK
CKSTLSPPEASPGPPAAPRARRRLGSGPDRELRKPEEPENGEPTAAATARRSKRERREED
RAPAEQVPRSPVIKISYSTPQGKGEVVKIPSRVHGSLEPFRPQQAPQDDGSQDPEVLDRE
SRDRPSCAPSASIPKLKLTRPVPAGADLPPPKIRLKPHRLGDSEHEPVYRAELVGELNGY
LRDSSPAPCADGPAGGLADLSSGSSGEDDDFKSCPQGPQGREGLAFLVSCPEGRADCASE
SACSSDSLDEARSSGSEGTPADTGDLSPGHGASAPSVSREARQTVPPLTVRLHTQSVSEC
ITEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQKEDGEPSWREAKVSWFGSPTTSFLS
ISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPEIRELLTQFET
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagccgcgcgccggctgccggctgccggtgcgggtggagcaggtcgtcaacggcgcg
ctggtggtcacggtgagctgcggcgagcggagcttcgcggggatcctgctggactgcacg
aaaaagtccggcctctttggcctacccccgttggctccgctgccccaggtcgatgagtcc
cctgtcaacgacagccatggccgggctcccgaggagggggatgcagaggtgatgcagctg
gggtccagctccccccctcctgcccgcggggttcagccccccgagaccacccgccccgag
ccacccccgcccctcgtgccgccgctgcccgccggaagcctgcccccgtaccctccctac
ttcgaaggcgcccccttccctcacccgctgtggctccgggacacgtacaagctgtgggtg
ccccagccgccgcccaggaccatcaagcgcacgcggcggcgtctgtcccgcaaccgcgac
ccggggcgcctcatcctcagcaccatccgcctgcggccgcgccaggtgctctgtgagaag
tgcaagagcacgctgagccccccggaggccagccccggacccccagccgcgcccagggcc
cgcaggaggctgggcagcggcccggacagggagctccgcaagccggaggagccggagaac
ggcgagcccacggctgcggccaccgccaggaggagcaagagggagaggcgcgaggaggac
agggccccggcagagcaggtcccgcggagcccggtcatcaagatctcctacagcacgccc
cagggcaagggagaggtggtcaagatcccctcccgcgtgcacggctctctggagcccttc
cgtccccagcaggccccgcaggacgacggcagccaggaccccgaggtgctggacagagag
tcccgggaccggccgtcctgcgcgccctcggcctccatccccaagttgaaactgacacgg
cctgtgccggccggcgcggacctgccgccccctaagatccgcctgaagccccaccgtctg
ggggacagcgagcacgagcccgtgtaccgggccgagctggtgggggagctgaacgggtac
ctgcgggacagctcgccggcgccctgtgcggacggccctgccggtgggctggcggacttg
tcttctggaagttcgggtgaggacgatgacttcaagagctgtccccagggtccacaggga
cgcgagggcttggcttttctcgtcagctgccctgaggggagagcggactgtgccagtgag
tcggcgtgcagcagcgacagcctggacgaggccagatcgtccggctcggaagggacgccg
gcagacacgggtgacctctcgcctggccacggcgcgtcagcgccctcggtgtccagagag
gctcgccaaacggtgccgcccctgacggtcaggctgcacacacagagcgtgtcggagtgc
atcacggaggacggcaggactgtggccgtgggggacatcgtctggggtaagatccatggt
tttccttggtggccggcgcgtgttcttgacatcagtctcggccagaaggaggacggagag
ccgtcttggcgagaagcgaaggtctcgtggtttggttctccgactacgtcgttcttgtct
atttcaaaactctcccctttctctgaatttttcaaactgagatttaatcgtaagaagaag
gggatgtatcggaaagctataaccgaggctgcaaatgccgcaagacacgtggccccggaa
atcagggagctcttaacccagtttgaaacgtaa

DBGET integrated database retrieval system