KEGG   Homo sapiens (human): 170589
Entry
170589            CDS       T01001                                 

Gene name
GPHA2, A2, GPA2, ZSIG51
Definition
(RefSeq) glycoprotein hormone subunit alpha 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Hormone_6 DAN Cys_knot
Other DBs
NCBI-GeneID: 170589
NCBI-ProteinID: NP_570125
OMIM: 609651
HGNC: 18054
Ensembl: ENSG00000149735
Vega: OTTHUMG00000165631
Pharos: Q96T91(Tbio)
UniProt: Q96T91 A0A024R579
Position
11q13.1
AA seq 129 aa
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGH
CESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQ
CDMCRLSRY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcctatggcgtcccctcaaaccctggtcctctatctgctggtcctggcagtcactgaa
gcctggggccaggaggcagtcatcccaggctgccacttgcaccccttcaatgtgacagtg
cgaagtgaccgccaaggcacctgccagggctcccacgtggcacaggcctgtgtgggccac
tgtgagtccagcgccttcccttctcggtactctgtgctggtggccagtggttaccgacac
aacatcacctccgtctctcagtgctgcaccatcagtggcctgaagaaggtcaaagtacag
ctgcagtgtgtggggagccggagggaggagctcgagatcttcacggccagggcctgccag
tgtgacatgtgtcgcctctctcgctactag

DBGET integrated database retrieval system