KEGG   Homo sapiens (human): 170685
Entry
170685            CDS       T01001                                 
Symbol
NUDT10, APS2, DIPP3-alpha, DIPP3a
Name
(RefSeq) nudix hydrolase 10
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    170685 (NUDT10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     170685 (NUDT10)
SSDB
Motif
Pfam: NUDIX preSET_CXC
Other DBs
NCBI-GeneID: 170685
NCBI-ProteinID: NP_001291892
OMIM: 300527
HGNC: 17621
Ensembl: ENSG00000122824
UniProt: Q8NFP7
Position
X:51332231..51337525
AA seq 164 aa
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagtgcaaacccaaccagacacggacctacgaccccgaggggttcaagaagcgggcg
gcgtgcctgtgcttccggagcgagcgcgaggacgaggtcctgttagtgagtagcagccgg
tacccggaccgctggatcgtgccgggcgggggcatggagcccgaggaggagccgggcggt
gcggcggtccgagaggtgtacgaagaggcgggagtcaaggggaagttaggccggctcctg
ggcgtcttcgaacagaaccaggaccccaagcacagaacgtacgtgtatgtactgactgtc
acggagctgctggaggattgggaagattcggttagcattgggaggaagcgagagtggttc
aaagtcgaagatgccatcaaggttctccagtgccacaagcccgtgcacgccgaatatctg
gagaaactaaagctgggcggttccccaaccaatggaaactccatggccccatcctcgcca
gatagcgatccctag

DBGET integrated database retrieval system