KEGG   Homo sapiens (human): 170689Help
Entry
170689            CDS       T01001                                 

Gene name
ADAMTS15
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 15
  KO
K08629  a disintegrin and metalloproteinase with thrombospondin motifs 15 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    170689 (ADAMTS15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     170689 (ADAMTS15)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   170689 (ADAMTS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 Pep_M12B_propep ADAM_CR_2 Reprolysin TSP_1 Reprolysin_5 Reprolysin_3 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 170689
NCBI-ProteinID: NP_620686
OMIM: 607509
HGNC: 16305
Ensembl: ENSG00000166106
Vega: OTTHUMG00000165657
Pharos: Q8TE58(Tbio)
UniProt: Q8TE58
Position
11q24.3
AA seq 950 aa AA seqDB search
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgctgggcatcctaaccctggctttcgccgggcgaaccgctggaggctctgag
ccagagcgggaggtagtcgttcccatccgactggacccggacattaacggccgccgctac
tactggcggggtcccgaggactccggggatcagggactcatttttcagatcacagcattt
caggaggacttttacctacacctgacgccggatgctcagttcttggctcccgccttctcc
actgagcatctgggcgtccccctccaggggctcaccgggggctcttcagacctgcgacgc
tgcttctattctggggacgtgaacgccgagccggactcgttcgctgctgtgagcctgtgc
ggggggctccgcggagcctttggctaccgaggcgccgagtatgtcattagcccgctgccc
aatgctagcgcgccggcggcgcagcgcaacagccagggcgcacaccttctccagcgccgg
ggtgttccgggcgggccttccggagaccccacctctcgctgcggggtggcctcgggctgg
aaccccgccatcctacgggccctggacccttacaagccgcggcgggcgggcttcggggag
agtcgtagccggcgcaggtctgggcgcgccaagcgtttcgtgtctatcccgcggtacgtg
gagacgctggtggtcgcggacgagtcaatggtcaagttccacggcgcggacctggaacat
tatctgctgacgctgctggcaacggcggcgcgactctaccgccatcccagcatcctcaac
cccatcaacatcgttgtggtcaaggtgctgcttcttagagatcgtgactccgggcccaag
gtcaccggcaatgcggccctgacgctgcgcaacttctgtgcctggcagaagaagctgaac
aaagtgagtgacaagcaccccgagtactgggacactgccatcctcttcaccaggcaggac
ctgtgtggagccaccacctgtgacaccctgggcatggctgatgtgggtaccatgtgtgac
cccaagagaagctgctctgtcattgaggacgatgggcttccatcagccttcaccactgcc
cacgagctgggccacgtgttcaacatgccccatgacaatgtgaaagtctgtgaggaggtg
tttgggaagctccgagccaaccacatgatgtccccgaccctcatccagatcgaccgtgcc
aacccctggtcagcctgcagtgctgccatcatcaccgacttcctggacagcgggcacggt
gactgcctcctggaccaacccagcaagcccatctccctgcccgaggatctgccgggcgcc
agctacaccctgagccagcagtgcgagctggcttttggcgtgggctccaagccctgtcct
tacatgcagtactgcaccaagctgtggtgcaccgggaaggccaagggacagatggtgtgc
cagacccgccacttcccctgggccgatggcaccagctgtggcgagggcaagctctgcctc
aaaggggcctgcgtggagagacacaacctcaacaagcacagggtggatggttcctgggcc
aaatgggatccctatggcccctgctcgcgcacatgtggtgggggcgtgcagctggccagg
aggcagtgcaccaaccccacccctgccaacgggggcaagtactgcgagggagtgagggtg
aaataccgatcctgcaatctggagccctgccccagctcagcctccggaaagagcttccgg
gaggagcagtgtgaggctttcaacggctacaaccacagcaccaaccggctcactctcgcc
gtggcatgggtgcccaagtactccggcgtgtctccccgggacaagtgcaagctcatctgc
cgagccaatggcactggctacttctatgtgctggcacccaaggtggtggacggcacgctg
tgctctcctgactccacctccgtctgtgtccaaggcaagtgcatcaaggctggctgtgat
gggaacctgggctccaagaagagattcgacaagtgtggggtgtgtgggggagacaataag
agctgcaagaaggtgactggactcttcaccaagcccatgcatggctacaatttcgtggtg
gccatccccgcaggcgcctcaagcatcgacatccgccagcgcggttacaaagggctgatc
ggggatgacaactacctggctctgaagaacagccaaggcaagtacctgctcaacgggcat
ttcgtggtgtcggcggtggagcgggacctggtggtgaagggcagtctgctgcggtacagc
ggcacgggcacagcggtggagagcctgcaggcttcccggcccatcctggagccgctgacc
gtggaggtcctctccgtggggaagatgacaccgccccgggtccgctactccttctatctg
cccaaagagcctcgggaggacaagtcctctcatcccaaggacccccggggaccctctgtc
ttgcacaacagcgtcctcagcctctccaaccaggtggagcagccggacgacaggccccct
gcacgctgggtggctggcagctgggggccgtgctccgcgagctgcggcagtggcctgcag
aagcgggcggtggactgccggggctccgccgggcagcgcacggtccctgcctgtgatgca
gcccatcggcccgtggagacacaagcctgcggggagccctgccccacctgggagctcagc
gcctggtcaccctgctccaagagctgcggccggggatttcagaggcgctcactcaagtgt
gtgggccacggaggccggctgctggcccgggaccagtgcaacttgcaccgcaagccccag
gagctggacttctgcgtcctgaggccgtgctga

DBGET integrated database retrieval system