KEGG   Homo sapiens (human): 170691
Entry
170691            CDS       T01001                                 

Gene name
ADAMTS17, WMS4
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 17
  KO
K08631  a disintegrin and metalloproteinase with thrombospondin motifs 17 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00673  Weill-Marchesani syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    170691 (ADAMTS17)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     170691 (ADAMTS17)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   170691 (ADAMTS17)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Pep_M12B_propep TSP1_spondin ADAM_spacer1 Reprolysin_5 Reprolysin_3 Reprolysin_2 TSP1_CCN Reprolysin_4 Peptidase_M10 PLAC DUF4953 Peptidase_M66
Other DBs
NCBI-GeneID: 170691
NCBI-ProteinID: NP_620688
OMIM: 607511
HGNC: 17109
Ensembl: ENSG00000140470
Vega: OTTHUMG00000149867
Pharos: Q8TE56(Tbio)
UniProt: Q8TE56
Position
15q26.3
AA seq 1095 aa
MCDGALLPPLVLPVLLLLVWGLDPGTAVGDAAADVEVVLPWRVRPDDVHLPPLPAAPGPR
RRRRPRTPPAAPRARPGERALLLHLPAFGRDLYLQLRRDLRFLSRGFEVEEAGAARRRGR
PAELCFYSGRVLGHPGSLVSLSACGAAGGLVGLIQLGQEQVLIQPLNNSQGPFSGREHLI
RRKWSLTPSPSAEAQRPEQLCKVLTEKKKPTWGRPSRDWRERRNAIRLTSEHTVETLVVA
DADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKINIQVTKLVLLRQRPAKLSIGHHG
ERSLESFCHWQNEEYGGARYLGNNQVPGGKDDPPLVDAAVFVTRTDFCVHKDEPCDTVGI
AYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKG
RNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHTVRLPHKLPGMHYSANEQCQILF
GMNATFCRNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPE
HVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKG
LPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGP
YETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCHLVKGDFSHARGTALKDSGKG
SINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKLPLHLMVLLFHDQDYGIHYEY
TVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND
SDCPQASRPEPQVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVAT
RPLYCPGPRPAAVQSCEGQDCLSIWEASEWSQCSASCGKGVWKRTVACTNSQGKCDASTR
PRAEEACEDYSGCYEWKTGDWSTCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAPY
RQCYQEVCNDRINANTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTC
RDFYANKMRQPPPNS
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtgtgacggcgccctgctgcctccgctcgtcctgcccgtgctgctgctgctggtttgg
ggactggacccgggcacagctgtcggcgacgcggcggccgacgtggaggtggtgctcccg
tggcgggtgcgccccgacgacgtgcacctgccgccgctgcccgcagcccccgggccccga
cggcggcgacgcccccgcacgcccccagccgccccgcgcgcccggcccggagagcgcgcc
ctgctgctgcacctgccggccttcgggcgcgacctgtaccttcagctgcgccgcgacctg
cgcttcctgtcccgaggcttcgaggtggaggaggcgggcgcggcccggcgccgcggccgc
cccgccgagctgtgcttctactcgggccgtgtgctcggccaccccggctccctcgtctcg
ctcagcgcctgcggcgccgccggcggcctggttggcctcattcagcttgggcaggagcag
gtgctaatccagcccctcaacaactcccagggcccattcagtggacgagaacatctgatc
aggcgcaaatggtccttgacccccagcccttctgctgaggcccagagacctgagcagctc
tgcaaggttctaacagaaaagaagaagccgacgtggggcaggccttcgcgggactggcgg
gagcggaggaacgctatccggctcaccagcgagcacacggtggagaccctggtggtggcc
gacgccgacatggtgcagtaccacggggccgaggccgcccagaggttcatcctgaccgtc
atgaacatggtatacaatatgtttcagcaccagagcctggggattaaaattaacattcaa
gtgaccaagcttgtcctgctacgacaacgtcccgctaagttgtccattgggcaccatggt
gagcggtccctggagagcttctgtcactggcagaacgaggagtatggaggagcgcgatac
ctcggcaataaccaggttcccggcgggaaggacgacccgcccctggtggatgctgccgtg
tttgtgaccaggacagatttctgtgtacacaaggatgaaccgtgtgacactgttggaatt
gcttacttaggaggtgtgtgcagtgctaagaggaagtgtgtgcttgccgaagacaatggt
ctcaatttggcctttaccatcgcccatgagctgggccacaacttgggcatgaaccacgac
gatgaccactcatcttgcgctggcaggtcccacatcatgtcaggagagtgggtgaaaggc
cggaacccaagtgacctctcttggtcctcctgcagccgagatgaccttgaaaacttcctc
aagtcaaaagtcagcacctgcttgctagtcacggaccccagaagccagcacacagtacgc
ctcccgcacaagctgccgggcatgcactacagtgccaacgagcagtgccagatcctgttt
ggcatgaatgccaccttctgcagaaacatggagcatctaatgtgtgctggactgtggtgc
ctggtagaaggagacacatcctgcaagaccaagctggaccctcccctggatggcaccgag
tgtggggcagacaagtggtgccgcgcgggggagtgcgtgagcaagacgcccatcccggag
catgtggacggagactggagcccgtggggcgcctggagcatgtgcagccgaacatgtggg
acgggagcccgcttcaggcagaggaaatgtgacaaccccccccctgggcctggaggcaca
cactgcccgggtgccagtgtagaacatgcggtctgcgagaacctgccctgccccaagggt
ctgcccagcttccgggaccagcagtgccaggcacacgaccggctgagccccaagaagaaa
ggcctgctgacagccgtggtggttgacgataagccatgtgaactctactgctcgcccctc
gggaaggagtccccactgctggtggccgacagggtcctggacggtacaccctgcgggccc
tacgagactgatctctgcgtgcacggcaagtgccagaaaatcggctgtgacggcatcatc
gggtctgcagccaaagaggacagatgcggggtctgcagcggggacggcaagacctgccac
ttggtgaagggcgacttcagccacgcccgggggacagctctcaaagactcgggtaagggg
tccatcaacagtgactggaagatagagctccccggagagttccagattgcaggcacaact
gttcgctatgtgagaagggggctgtgggagaagatctctgccaagggaccaaccaaacta
ccgctgcacttgatggtgttgttatttcacgaccaagattatggaattcattatgaatac
actgttcctgtaaaccgcactgcggaaaatcaaagcgaaccagaaaaaccgcaggactct
ttgttcatctggacccacagcggctgggaagggtgcagtgtgcagtgcggcggaggggag
cgcagaaccatcgtctcgtgtacacggattgtcaacaagaccacaactctggtgaacgac
agtgactgccctcaagcaagccgcccagagccccaggtccgaaggtgcaacttgcacccc
tgccagtcacggtgggtggcaggcccgtggagcccctgctcggcgacctgtgagaaaggc
ttccagcaccgggaggtgacctgcgtgtaccagctgcagaacggcacacacgtcgctacg
cggcccctctactgcccgggcccccggccggcggcagtgcagagctgtgaaggccaggac
tgcctgtccatctgggaggcgtctgagtggtcacagtgctctgccagctgtggtaaaggg
gtgtggaaacggaccgtggcgtgcaccaactcacaagggaaatgcgacgcatccacgagg
ccgagagccgaggaggcctgcgaggactactcaggctgctacgagtggaaaactggggac
tggtctacgtgctcgtcgacctgcgggaagggcctgcagtcccgggtggtgcagtgcatg
cacaaggtcacagggcgccacggcagcgagtgccccgccctctcgaagcctgccccctac
agacagtgctaccaggaggtctgcaacgacaggatcaacgccaacaccatcacctccccc
cgccttgctgctctgacctacaaatgcacacgagaccagtggacggtatattgccgggtc
atccgagaaaagaacctctgccaggacatgcggtggtaccagcgctgctgccagacctgc
agggacttctatgcaaacaagatgcgccagccaccgccgaactcgtga

DBGET integrated database retrieval system