KEGG   Homo sapiens (human): 170712
Entry
170712            CDS       T01001                                 
Symbol
COX7B2
Name
(RefSeq) cytochrome c oxidase subunit 7B2
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    170712 (COX7B2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    170712 (COX7B2)
  09159 Environmental adaptation
   04714 Thermogenesis
    170712 (COX7B2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    170712 (COX7B2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    170712 (COX7B2)
   05012 Parkinson disease
    170712 (COX7B2)
   05014 Amyotrophic lateral sclerosis
    170712 (COX7B2)
   05016 Huntington disease
    170712 (COX7B2)
   05020 Prion disease
    170712 (COX7B2)
   05022 Pathways of neurodegeneration - multiple diseases
    170712 (COX7B2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    170712 (COX7B2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    170712 (COX7B2)
SSDB
Motif
Pfam: COX7B Deltameth_res
Other DBs
NCBI-GeneID: 170712
NCBI-ProteinID: NP_570972
OMIM: 609811
HGNC: 24381
Ensembl: ENSG00000170516
Pharos: Q8TF08(Tdark)
UniProt: Q8TF08
Position
4:complement(46734827..46909245)
AA seq 81 aa
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
NT seq 246 nt   +upstreamnt  +downstreamnt
atgatgtttcccttggccagaaatgcactaagcagtctcaagattcaaagcattctgcaa
agcatggcaagacatagccatgtaaaacactcaccagattttcatgataaatatggtaat
gctgtgctagccagtggaactgctttctgtgttgctacatgggtgtttacagccactcag
attggaatagaatggaacctatcccctgttggcagagttaccccaaaagagtggaaacat
cagtaa

DBGET integrated database retrieval system