KEGG   Homo sapiens (human): 170850Help
Entry
170850            CDS       T01001                                 

Gene name
KCNG3, KV10.1, KV6.3
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily G member 3
  KO
K04902  potassium voltage-gated channel subfamily G member 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   170850 (KCNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 Lig_chan
Motif
Other DBs
NCBI-GeneID: 170850
NCBI-ProteinID: NP_579875
OMIM: 606767
HGNC: 18306
Ensembl: ENSG00000171126
Vega: OTTHUMG00000128604
Pharos: Q8TAE7(Tclin)
UniProt: Q8TAE7
Position
2p21
AA seq 436 aa AA seqDB search
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
SDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
VIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRF
IVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSI
PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
FRSARYSRSLSTEFLN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgggcgcagcggggcggcctcggtggtgctgaacgtgggcggcgcccggtat
tcgctgtcccgggagctgctgaaggacttcccgctgcgccgcgtgagccggctgcacggc
tgccgctccgagcgcgacgtgctcgaggtgtgcgacgactacgaccgcgagcgcaacgag
tacttcttcgaccggcactcggaggccttcggcttcatcctgctctacgtgcgcggccac
ggcaagctgcgcttcgcgccgcggatgtgcgagctctccttctacaacgagatgatctac
tggggcctggagggcgcgcacctcgagtactgctgccagcgccgcctcgacgaccgcatg
tccgacacctacaccttctactcggccgacgagccgggcgtgctgggccgcgacgaggcg
cgccccggcggggccgaggcggctccctccaggcgctggctggagcgcatgcggcggacc
ttcgaggagcccacgtcgtcgctggccgcgcagatcctggctagcgtgtcggtggtgttc
gtgatcgtgtccatggtggtgctgtgcgccagcacgttgcccgactggcgcaacgcagcc
gccgacaaccgcagcctggatgaccggagcaggtactccgccggccctgggagggagccc
tccgggataattgaagctatctgcataggttggttcactgccgagtgcatcgtgaggttc
attgtctccaaaaacaagtgtgagtttgtcaagagacccctgaacatcattgatttactg
gcaatcacgccgtattacatctctgtgttgatgacagtgtttacaggcgagaactctcaa
ctccagagggctggagtcaccttgagggtacttagaatgatgaggattttttgggtgatt
aagcttgcccgtcacttcattggtcttcagacactcggtttgactctcaaacgttgctac
cgagagatggttatgttacttgtcttcatttgtgttgccatggcaatctttagtgcactt
tctcagcttcttgaacatgggctggacctggaaacatccaacaaggactttaccagcatt
cctgctgcctgctggtgggtgattatctctatgactacagttggctatggagatatgtat
cctatcacagtgcctggaagaattcttggaggagtttgtgttgtcagtggaattgttcta
ttggcattacctatcacttttatctaccatagctttgtgcagtgttatcatgagctcaag
tttagatctgctaggtatagtaggagcctctccactgaattcctgaattaa

DBGET integrated database retrieval system