KEGG   Homo sapiens (human): 170960
Entry
170960            CDS       T01001                                 

Gene name
ZNF721
Definition
(RefSeq) zinc finger protein 721
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    170960 (ZNF721)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    170960 (ZNF721)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    170960 (ZNF721)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 XPA_N zf-C2H2_11 zf-C2H2_jaz zf_UBZ Zn-ribbon_8 GAGA C1_4 zinc_ribbon_15 DZR zf-trcl BolA KRAB LIM
Other DBs
NCBI-GeneID: 170960
NCBI-ProteinID: NP_597731
HGNC: 29425
Ensembl: ENSG00000182903
Vega: OTTHUMG00000112450
Pharos: Q8TF20(Tdark)
UniProt: Q8TF20
Position
4p16.3
AA seq 923 aa
MLENYRNLVSLAMCSHFTQDFLPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSMNVCK
VQKGVYNGINKCLSNTQSKIFQCNARVKVFSKFANSNKDKTRHTGEKHFKCNECGKSFQK
FSDLTQHKGIHAGEKPYTCEERGKDFGWYTDLNQHKKIHTGEKPYKCEECGKAFNRSTNL
TAHKRIHNREKAYTGEDRDRAFGWSTNLNEYKKIHTGDKPYKCKECGKAFMHSSHLNKHE
KIHTGEKPYKCKECGKVISSSSSFAKHKRIHTGEKPFKCLECGKAFNISTTLTKHRRIHT
GEKPYTCEVCGKAFRQSANLYVHRRIHTGEKPYTCGECGKTFRQSANLYVHRRIHTGEKP
YKCEDCGKAFGRYTALNQHKKIHTGEKPYKCEECGKAFNSSTNLTAHKRIHTREKPYTCE
DRGRAFGLSTNLNEYKKIHTGDKPYKCKECGKAFIHSLHLNKHEKIHTGKKPYKCKQCGK
VITSSSSFAKHKRIHTGEKPFECLECGKAFTSSTTLTKHRRIHTGEKPYTCEVCGKAFRQ
SAILYVHRRIHTGEKPYTCEECGKTFRQSANLYVHRRIHTGEKPYKCEECGKAFGRYTDL
NQHKKIHTGEKLYKCEECGKDFVWYTDLNQQKKIYTGEKPYKCEECGKAFAPSTDLNQHT
KILTGEQSYKCEECGKAFGWSIALNQHKKIHTGEKPYKCEECGKAFSRSRNLTTHRRVHT
REKPYKCEDRGRSFGWSTNLNEYKKIHTGDKLYKCKECGKVFKQSSHLNRHEKIHTGKKP
YKCKECGKVITSSSSFAKHKRIHTGEKPFKCLECGKAFTSSTTLTKHRRIHTGEKPYTCE
ECGKAFRQSAILYVHRRIHTGEKPYTCGECGKTFRQSANLYAHKKIHTGEKPYTCGDCGK
TFRQSANLYAHKKIHTGDKTIQV
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgttggagaactacagaaacctggtctccctagctatgtgttctcatttcacccaagac
tttttgccagtgcaggggatagaagattcattccacaaacttatactgagaagatatgag
aaatgtgggcatgataatttacaattaaggaaaggctgtaaaagtatgaacgtgtgtaaa
gtgcagaagggagtttataatggaattaataaatgcttgtcaaatactcagagcaaaata
tttcaatgtaatgcacgtgtcaaagtttttagtaaatttgcaaattcaaacaaagataag
acaagacatactggagagaaacactttaaatgtaacgaatgtggcaagtcatttcagaag
ttctcagacctaactcaacataaaggaattcatgctggagagaaaccctacacttgtgaa
gaacgtggcaaagactttggatggtacacagacctgaatcaacacaagaaaattcatact
ggagagaaaccttacaaatgtgaagaatgtggcaaagcctttaataggtcaacaaacctt
actgcacataagagaattcacaacagagagaaagcttacacaggtgaagatcgtgacaga
gcctttggatggtccacaaacctgaatgaatataagaaaattcatactggagataaaccc
tacaaatgtaaagaatgtgggaaagcctttatgcattcctcacacctgaataaacatgag
aaaattcatactggagagaaaccctacaaatgtaaggaatgtggcaaagtcatttcctca
tcctcaagctttgctaaacataagaggattcatactggcgagaaaccctttaaatgttta
gaatgtggtaaagcctttaatatttccacaacccttactaaacataggagaattcatact
ggagagaaaccctacacatgtgaagtatgtggcaaagcctttagacagtccgcaaacctt
tatgtacataggagaattcatactggagagaaaccctacacatgtggagaatgtggcaaa
acctttagacagtccgcaaacctttacgtacataggagaattcatactggagagaaacct
tacaaatgcgaagactgtggcaaagcctttggacggtacacagccctgaatcaacacaag
aaaattcatactggagagaaaccttacaaatgtgaagagtgtggcaaagcctttaatagt
tcaacaaaccttactgcacataagagaattcacaccagagagaaaccctacacatgtgaa
gatcgtggcagagcctttggattgtccacaaacctgaatgaatataagaaaattcatact
ggagataaaccctacaaatgtaaagaatgtgggaaagcctttatacattccttgcacctg
aataaacatgagaaaattcatactggaaagaaaccctacaaatgtaagcaatgtggcaaa
gtcattacctcatcctcaagctttgctaaacataagaggattcatactggcgagaaaccc
tttgaatgtttagaatgtggtaaagcgtttactagttccacaacccttactaaacatagg
agaattcatactggagagaaaccctacacatgtgaagtatgtggcaaagcctttagacag
tccgcaatcctttatgtacataggagaattcatactggagagaaaccctacacatgtgaa
gaatgtggcaaaacctttagacagtccgcaaacctttatgtacataggagaattcatact
ggagagaaaccttacaaatgtgaagagtgtggcaaagcctttggacggtacacagacctg
aatcaacacaagaaaattcatactggagagaaactttacaaatgtgaagagtgtggcaaa
gactttgtatggtacacggacctgaatcaacagaagaaaatttacactggggagaaacct
tacaaatgtgaagagtgtggcaaagcctttgccccatcaacagacctgaatcaacacacg
aaaattcttactggagagcaaagttacaaatgtgaagagtgtggcaaagcctttggatgg
tccatagccctgaatcaacacaagaaaattcatactggagaaaaaccttacaaatgtgaa
gagtgtggcaaagcctttagtaggtcaagaaaccttactacacataggagagttcacact
agggagaaaccctacaaatgtgaagatcgtggcagatcctttggatggtccacaaacctg
aacgaatataagaaaattcatactggagataaactctacaaatgtaaagaatgtgggaaa
gtgtttaaacagtcctcacacctgaatagacatgagaaaattcatactggaaagaaaccc
tacaaatgtaaggaatgtggcaaagtcattacgtcatcctcaagctttgctaaacataag
aggattcatacaggtgagaaaccctttaaatgtttagaatgtggtaaagcgtttactagt
tccacaacccttactaaacataggagaattcatactggagagaaaccctacacatgtgaa
gaatgtggcaaagcctttagacagtcagcaatcctttatgtacataggagaattcatact
ggagagaaaccctacacatgtggagaatgtggcaaaacctttagacagtctgcaaatctt
tatgcgcataagaaaattcatactggagagaaaccctacacgtgtggagactgtggcaaa
acctttagacagtctgcaaatctttatgcacataagaaaattcatactggagataaaacc
atacaagtgtaa

DBGET integrated database retrieval system