KEGG   Homo sapiens (human): 171392
Entry
171392            CDS       T01001                                 

Gene name
ZNF675, TBZF, TIZ
Definition
(RefSeq) zinc finger protein 675
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    171392 (ZNF675)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    171392 (ZNF675)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    171392 (ZNF675)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf_UBZ XPA_N Zn-ribbon_8 zinc_ribbon_15 zf-AN1 End_beta_propel
Other DBs
NCBI-GeneID: 171392
NCBI-ProteinID: NP_612203
HGNC: 30768
Ensembl: ENSG00000197372
Vega: OTTHUMG00000183384
Pharos: Q8TD23(Tbio)
UniProt: Q8TD23
Position
19p12
AA seq 568 aa
MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK
EPLTVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD
ECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRS
FCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQF
SNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN
IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG
EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY
KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER
CDKAFNQSANLTKHKKIHTGEKLQNWNV
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggactgttgacatttagggatgtggccatagaattctctctggaagaatggcaatgc
ctggacactgcacagcggaatttatataaaaatgtgattttagagaactacagaaacctg
gtcttcctgggtattgctgtctctaagcaagacctgatcacctgtctggagcaagaaaaa
gagcctttgactgtgaagagacatgagatggtgaatgaacccccagtaatgtgttctcat
tttgcccaagagttttggccagagcagaacataaaagattcttttgaaaaagtgacactg
agaagatatgaaaaatgtggaaatgataattttcagttaaaaggctgtaaaagtgtggat
gaatgtaagttgcacaagggaggttataatggacttaaccaatgtttaccaactatgcag
agcaaaatgtttcaatgtgataaatatgtgaaagtctttaataaattttcacattcagat
agacataagataaaacatatggaaaataaacctttcaaatgtaaagaatgtggcagatca
ttttgcatgctttcacacctaactcgacatgaaagaaattataccaaggtgaatttctgc
aaatgtgaagaatgtgaaaaagctgttaaccaatcttcaaagcttactaaacataaaaga
atttatacttgtgagaaactctacaaatgtcaagaatgtgacagaacttttaaccaattc
tcaaaccttactgaatataaaaaagattatgctcgagagaaaccatacaaatgtgaagaa
tgtggcaaagcctttaaccagtcctcacaccttactacacataagataattcatacagga
gagaaaccctacaaatgtgaagaatgtggcaaagcctttaaccagttctcaaatcttact
acacataaaaaaattcatactggagagcaaccctacatatgtgaagaatgtggcaaggct
tttacccaatcctcaacccttactacacataagagaattcatactggagaaaaaccctac
aaatgtgaagaatgtggaaaagcttttaaccgatcctcaaaacttactgaacataaaaac
attcatactggagagcaaccctacaaatgtgaggaatgcggcaaagcttttaaccgatcc
tcaaatcttacggaacataggaaaattcataccgaagagaaaccctacaaatgtaaagaa
tgtggcaaagcttttaaacactcctcagcccttactacacataagagaattcacactgga
gagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccgatcctcaaaacttact
gaacataagaaacttcatactggaaagaaaccctacaaatgtgaagaatgtggcaaagct
tttatccaatcctcaaaacttactgaacataagaaaattcattctggagagataccctac
aagtgtgaagaatgtggcaaagcttttaaacactcctcatcccttactacacataaaaga
attcatactggggagaaaccctacaaatgtgaagaatgtggcaaagcttttagccgatcc
tcaaaacttactgaacataagataattcatactggagagaaaccctataaatgtgagaga
tgtgacaaagcttttaaccaatctgcaaaccttactaaacataaaaaaatacatactgga
gagaaactacagaactggaatgtgtga

DBGET integrated database retrieval system