KEGG   Homo sapiens (human): 171425
Entry
171425            CDS       T01001                                 
Symbol
CLYBL, CLB
Name
(RefSeq) citramalyl-CoA lyase
  KO
K11390  citrate lyase subunit beta-like protein [EC:4.1.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    171425 (CLYBL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.-
    4.1.-.-
     171425 (CLYBL)
SSDB
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Other DBs
NCBI-GeneID: 171425
NCBI-ProteinID: NP_996531
OMIM: 609686
HGNC: 18355
Ensembl: ENSG00000125246
Pharos: Q8N0X4(Tbio)
UniProt: Q8N0X4
Structure
Position
13:99606690..99909444
AA seq 340 aa
MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIK
KIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDL
ETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFK
AVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQA
IDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAA
FKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcgctacgtctgctgcggagggcggcgcgcggagctgcggcggcggcgctgctgagg
ctgaaagcgtctctagcagctgatatccccagacttggatatagttcctcatcccatcac
aagtacatcccccggagggcagtgctttatgtacctggaaatgatgaaaagaaaataaag
aagattccatccctgaatgtagattgtgcagtgctcgactgtgaggatggagtggctgca
aacaaaaagaatgaagctcgactgagaattgtaaaaactcttgaagacattgatctgggc
cctactgaaaaatgtgtgagagtcaactcagtttccagtggtctggcggaagaagaccta
gagacccttttgcaatcccgggtccttccttccagcctgatgctaccaaaggtggaaagt
cctgaagaaatccagtggtttgcagacaaattttcattccacttaaaaggccgaaaactt
gaacaaccaatgaatttaatcccttttgtggaaactgcaatgggtttgctcaattttaag
gcagtgtgtgaagaaaccctgaaggtcgggcctcaagtaggtctctttctagatgcagtc
gtttttggaggagaagactttcgagccagcataggtgcaacaagtagtaaagaaaccctg
gatattctctacgcccggcaaaagattgttgtcatagcgaaagcctttggtctccaagcc
atagatctggtgtacattgactttcgagatggagctgggctgcttagacagtcacgagaa
ggagccgccatgggcttcactggtaagcaggtgattcaccctaaccaaattgccgtggtc
caggagcagttttctccttcccctgaaaaaattaagtgggctgaagaactgattgctgcc
tttaaagaacatcaacaattaggaaagggggcctttactttccaagggagtatgatcgac
atgccattactgaagcaggcccagaacactgttacgcttgccacctccatcaaggaaaaa
tga

DBGET integrated database retrieval system