KEGG   Homo sapiens (human): 171546
Entry
171546            CDS       T01001                                 
Symbol
SPTSSA, C14orf147, SSSPTA
Name
(RefSeq) serine palmitoyltransferase small subunit A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SPT_ssu-like
Other DBs
NCBI-GeneID: 171546
NCBI-ProteinID: NP_612145
OMIM: 613540
HGNC: 20361
Ensembl: ENSG00000165389
Pharos: Q969W0(Tdark)
UniProt: Q969W0
Structure
Position
14:complement(34432788..34462240)
AA seq 71 aa
MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI
MAILHYFEIVQ
NT seq 216 nt   +upstreamnt  +downstreamnt
atggcggggatggcgctggcgcgggcctggaagcagatgtcctggttctactaccagtac
ctgctggtcacggcgctctacatgctggagccctgggagcggacggtgttcaattccatg
ctggtttccattgtggggatggcactatacacaggatacgtcttcatgccccagcacatc
atggcgatattgcactactttgaaatcgtacaatga

DBGET integrated database retrieval system