KEGG   Homo sapiens (human): 171568Help
Entry
171568            CDS       T01001                                 

Gene name
POLR3H, RPC22.9, RPC8
Definition
(RefSeq) RNA polymerase III subunit H
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    171568 (POLR3H)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    171568 (POLR3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    171568 (POLR3H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     171568 (POLR3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Motif
Other DBs
NCBI-GeneID: 171568
NCBI-ProteinID: NP_001018060
HGNC: 30349
Ensembl: ENSG00000100413
Vega: OTTHUMG00000150971
Pharos: Q9Y535(Tbio)
UniProt: Q9Y535 A0A024R1P3
Position
22q13.2
AA seq 204 aa AA seqDB search
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctggtggaaatggtggacaccgtccggatccccccttggcagtttgagagg
aagctcaacgactccattgccgaggagctgaacaagaagttggccaacaaggtcgtgtac
aacgtgggactctgcatttgtctgtttgatatcaccaaactggaggatgcctatgtattc
cctggggatggcgcatcacacaccaaagtccattttcgctgcgtggtgtttcatccattc
ctagatgagattctcattgggaagatcaaaggctgcagcccagaaggagtgcacgtctct
ctaggcttcttcgatgacattctcatccccccagagtcactgcagcagccagccaagttc
gacgaagcggagcaggtgtgggtgtgggagtacgagacggaggaaggagcacacgacctc
tacatggacaccggcgaggagatccgcttccgggtggtggacgagagctttgttgacacg
tcccccacagggcccagctcagcagatgccaccacttccagtgaggagctgccaaagaag
gaggctccgtacacgcttgtgggatccatcagtgagccaggcctgggccttctctcctgg
tggaccagcaactag

DBGET integrated database retrieval system