KEGG   Homo sapiens (human): 1716Help
Entry
1716              CDS       T01001                                 

Gene name
DGUOK, MTDPS3, NCPH, PEOB4, dGK
Definition
(RefSeq) deoxyguanosine kinase
  KO
K00904  deoxyguanosine kinase [EC:2.7.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Disease
H00469  Mitochondrial DNA depletion syndrome
H01395  Autosomal recessive progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    1716 (DGUOK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.113  deoxyguanosine kinase
     1716 (DGUOK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_16 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 1716
NCBI-ProteinID: NP_550438
OMIM: 601465
HGNC: 2858
Ensembl: ENSG00000114956
Vega: OTTHUMG00000129819
Pharos: Q16854(Tbio)
UniProt: Q16854 E5KSL5
Structure
PDB: 

Position
2p13.1
AA seq 277 aa AA seqDB search
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTK
TYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLK
VQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEF
ASRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTKLHFE
ALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgggccgcctctttctaagtcggcttcgagcacccttcagttccatggccaag
agcccactcgagggcgtttcctcctccagaggcctgcacgcggggcgcgggccccgaagg
ctctccatcgaaggcaacattgctgtgggaaagtccacgtttgtgaagttactcacgaaa
acttacccagaatggcacgtagctacagaacctgtagcaacatggcagaatatccaggct
gctggcacccaaaaagcctgcactgcccaaagtcttggaaacttgctggatatgatgtac
cgggagccagcacgatggtcctacacattccagacattttcctttttgagccgcctgaaa
gtacagctggagcccttccctgagaaactcttacaggccaggaagccagtacagatcttt
gagaggtctgtgtacagtgacaggtatatctttgcaaagaatctttttgaaaatggttcc
ctcagtgacatcgagtggcatatctatcaggactggcattcttttctcctgtgggagttt
gccagccggatcacattacatggcttcatctacctccaggcttctccccaggtttgtttg
aagagactgtaccagagggccagggaggaggagaaaggaattgagctggcctatctagag
cagctgcatggccaacacgaagcctggcttattcacaagacaacgaagctccactttgag
gctctgatgaacattccagtgctggtgttggatgtcaatgatgatttttctgaggaagta
accaaacaagaagacctcatgagagaggtaaacacctttgtaaagaatctgtaa

DBGET integrated database retrieval system