KEGG   Homo sapiens (human): 1738Help
Entry
1738              CDS       T01001                                 

Gene name
DLD, DLDD, DLDH, E3, GCSL, LAD, PHE3
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00260  Glycine, serine and threonine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00620  Pyruvate metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H00172  Maple syrup urine disease (MSUD)
H02000  Dihydrolipoamide dehydrogenase deficiency
H02006  Alpha-ketoglutarate dehydrogenase complex (KGDHC) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    1738 (DLD)
   00020 Citrate cycle (TCA cycle)
    1738 (DLD)
   00620 Pyruvate metabolism
    1738 (DLD)
   00630 Glyoxylate and dicarboxylate metabolism
    1738 (DLD)
   00640 Propanoate metabolism
    1738 (DLD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    1738 (DLD)
   00280 Valine, leucine and isoleucine degradation
    1738 (DLD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1738 (DLD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     1738 (DLD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   1738 (DLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored FAD_binding_2 Pyr_redox_3 NAD_binding_8 GIDA AlaDh_PNT_C FAD_binding_3 HI0933_like K_oxygenase Thi4 Mqo
Motif
Other DBs
NCBI-GeneID: 1738
NCBI-ProteinID: NP_000099
OMIM: 238331
HGNC: 2898
Ensembl: ENSG00000091140
Vega: OTTHUMG00000154813
Pharos: P09622(Tbio)
UniProt: P09622 A0A024R713
Structure
PDB: 

Position
7q31.1
AA seq 509 aa AA seqDB search
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcagagctggagtcgtgtgtactgctccttggccaagagaggccatttcaatcgaata
tctcatggcctacagggactttctgcagtgcctctgagaacttacgcagatcagccgatt
gatgctgatgtaacagttataggttctggtcctggaggatatgttgctgctattaaagct
gcccagttaggcttcaagacagtctgcattgagaaaaatgaaacacttggtggaacatgc
ttgaatgttggttgtattccttctaaggctttattgaacaactctcattattaccatatg
gcccatggaaaagattttgcatctagaggaattgaaatgtccgaagttcgcttgaattta
gacaagatgatggagcagaagagtactgcagtaaaagctttaacaggtggaattgcccac
ttattcaaacagaataaggttgttcatgtcaatggatatggaaagataactggcaaaaat
caagtcactgctacgaaagctgatggcggcactcaggttattgatacaaagaacattctt
atagccacgggttcagaagttactccttttcctggaatcacgatagatgaagatacaata
gtgtcatctacaggtgctttatctttaaaaaaagttccagaaaagatggttgttattggt
gcaggagtaataggtgtagaattgggttcagtttggcaaagacttggtgcagatgtgaca
gcagttgaatttttaggtcatgtaggtggagttggaattgatatggagatatctaaaaac
tttcaacgcatccttcaaaaacaggggtttaaatttaaattgaatacaaaggttactggt
gctaccaagaagtcagatggaaaaattgatgtttctattgaagctgcttctggtggtaaa
gctgaagttatcacttgtgatgtactcttggtttgcattggccgacgaccctttactaag
aatttgggactagaagagctgggaattgaactagatcccagaggtagaattccagtcaat
accagatttcaaactaaaattccaaatatctatgccattggtgatgtagttgctggtcca
atgctggctcacaaagcagaggatgaaggcattatctgtgttgaaggaatggctggtggt
gctgtgcacattgactacaattgtgtgccatcagtgatttacacacaccctgaagttgct
tgggttggcaaatcagaagagcagttgaaagaagagggtattgagtacaaagttgggaaa
ttcccatttgctgctaacagcagagctaagacaaatgctgacacagatggcatggtgaag
atccttgggcagaaatcgacagacagagtactgggagcacatattcttggaccaggtgct
ggagaaatggtaaatgaagctgctcttgctttggaatatggagcatcctgtgaagatata
gctagagtctgtcatgcacatccgaccttatcagaagcttttagagaagcaaatcttgct
gcgtcatttggcaaatcaatcaacttttga

DBGET integrated database retrieval system