KEGG   Homo sapiens (human): 1739Help
Entry
1739              CDS       T01001                                 

Gene name
DLG1, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg
Definition
(RefSeq) discs large MAGUK scaffold protein 1
  KO
K12076  disks large protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
N00340  The Scribble/Dlg/Lgl polarity module
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1739 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1739 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    1739 (DLG1)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    1739 (DLG1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    1739 (DLG1)
   05165 Human papillomavirus infection
    1739 (DLG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1739 (DLG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    1739 (DLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 1739
NCBI-ProteinID: NP_001091894
OMIM: 601014
HGNC: 2900
Ensembl: ENSG00000075711
Vega: OTTHUMG00000047972
Pharos: Q12959(Tbio)
UniProt: Q12959
Structure
PDB: 

Position
3q29
AA seq 904 aa AA seqDB search
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIIL
GPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIE
AGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME
MNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPA
KEKL
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcaccttttggaggaatatcgttca
aaactaagccaaactgaagacagacagctcagaagttccatagaacgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcgttcaaagccgtctgaaccaattcaacctgtgaat
acttgggagatttccagccttccaagctctactgtgacttcagagacactgccaagcagc
cttagccctagtgtagagaaatacaggtatcaggatgaagatacacctcctcaagagcat
atttccccacaaatcacaaatgaagtgataggtccagaattggttcatgtctcagagaag
aacttatcagagattgagaatgtccatggatttgtttctcattctcatatttcaccaata
aagccaacagaagctgttcttccctctcctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccaccataccacaggcaaatcctcccccagta
ctggtcaacacagatagcttggaaacaccaacttacgttaatggcacagatgcagattat
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacggacaacccacacattggagatgactcaagtattttcattaccaaaattatcaca
gggggagcagccgcccaagatggaagattgcgggtcaatgactgtatattacgagtaaat
gaagtagatgttcgtgatgtaacacatagcaaagcagttgaagcgttgaaagaagcaggg
tctattgtacgcttgtatgtaaaaagaaggaaaccagtgtcagaaaaaataatggaaata
aagctcattaaaggtcctaaaggtcttgggtttagcattgctggaggtgttggaaatcag
catattcctggggataatagcatctatgtaaccaaaataattgaaggaggtgcagcacat
aaggatggcaaacttcagattggagataaacttttagcagtgaataacgtatgtttagaa
gaagttactcatgaagaagcagtaactgccttaaagaacacatctgattttgtttatttg
aaagtggcaaaacccacaagtatgtatatgaatgatggctatgcaccacctgatatcacc
aactcttcttctcagcctgttgataaccatgttagcccatcttccttcttgggccagaca
ccagcatctccagccagatactccccagtttctaaagcagtacttggagatgatgaaatt
acaagggaacctagaaaagttgttcttcatcgtggctcaacgggccttggtttcaacatt
gtaggaggagaagatggagaaggaatatttatttcctttatcttagccggaggacctgct
gatctaagtggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctc
agagctgctagtcatgagcaggcagcagctgcattgaaaaatgctggccaggctgtcaca
attgttgcacaatatcgacctgaagaatacagtcgttttgaagctaaaatacatgattta
cgggagcagatgatgaatagtagtattagttcagggtcaggttctcttcgaactagccag
aagcgatccctctatgtcagagccctttttgattatgacaagactaaagacagtgggctt
cccagtcagggactgaacttcaaatttggagatatcctccatgttattaatgcttctgat
gatgaatggtggcaagccaggcaggttacaccagatggtgagagcgatgaggtcggagtg
attcccagtaaacgcagagttgagaagaaagaacgagcccgattaaaaacagtgaaattc
aattctaaaacgagagataaaggggagatccctgacgacatgggatcaaaaggcctgaag
catgtaacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaagaatacgtc
ttatcttatgaaccagtgaatcaacaagaagttaattatactcgaccagtgatcatattg
ggacctatgaaagacaggataaatgatgacttgatctcagaatttcctgacaaatttgga
tcctgtgttcctcatacaactagaccaaaacgagattatgaggtagatggaagagattat
cattttgtgacttcaagagagcagatggaaaaagatatccaggaacataaattcattgaa
gctggccagtataacaatcatctatatggaacaagtgttcagtctgtacgagaagtagca
gaaaagggcaaacactgtatccttgatgtgtctggaaatgccataaagagattacagatt
gcacagctttaccctatctccatttttattaaacccaaatccatggaaaatatcatggaa
atgaataagcgtctaacagaagaacaagccagaaaaacatttgagagagccatgaaactg
gaacaggagtttactgaacatttcacagctattgtacagggggatacgctggaagacatt
tacaaccaagtgaaacagatcatagaagaacaatctggttcttacatctgggttccggca
aaagaaaagctatga

DBGET integrated database retrieval system