KEGG   Homo sapiens (human): 1741Help
Entry
1741              CDS       T01001                                 

Gene name
DLG3, MRX, MRX90, NEDLG, PPP1R82, SAP102, XLMR
Definition
(RefSeq) discs large MAGUK scaffold protein 3
  KO
K21098  discs large protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
N00193  HPV E6 to host-cell-protein inhibition
Disease
H00480  Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1741 (DLG3)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    1741 (DLG3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    1741 (DLG3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     1741 (DLG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 1741
NCBI-ProteinID: NP_066943
OMIM: 300189
HGNC: 2902
Ensembl: ENSG00000082458
Vega: OTTHUMG00000021778
Pharos: Q92796(Tbio)
UniProt: Q92796 Q59FY1
Structure
PDB: 

Position
Xq13.1
AA seq 817 aa AA seqDB search
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQV
NGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVN
DCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSI
AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKN
TSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPP
QVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPA
DLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDL
REQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASD
DEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDY
YGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTT
RPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCI
LDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEY
FTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagcaccagcactgctgtaagtgccctgagtgctatgaggtgacccgcctggcc
gccctgcggcgcctcgagcctccgggctacggcgactggcaagtccccgacccttacggg
ccaggtgggggcaacggcgccagcgcgggttatgggggctacagctcgcagaccttgccc
tcgcaggcgggggccacccccacccctcgcaccaaggccaagctcatccccaccggccgg
gatgtggggccggtgcctcctaagccagtcccgggcaagagcacccccaaactcaacggc
agcggccccagctggtggccagagtgcacctgtaccaaccgggactggtatgagcaggtg
aatggcagtgatggcatgttcaaatatgaggaaatcgtacttgagaggggcaactctggc
ctgggcttcagtatcgcaggtggcatcgacaatccccatgtccctgatgaccctggcatc
tttattaccaagattatccctggtggagcagctgccatggatgggaggctgggggtgaat
gactgtgtgctgcgggtgaatgaggtggacgtgtcggaggtggtacacagccgggcggtg
gaggcgctgaaggaggcaggccctgtggtgcgattggtggtgcggaggcgacagcctcca
cccgagaccatcatggaggtcaacctgctcaaagggcccaaaggcctgggtttcagcatt
gctgggggtattggcaaccagcacatcccaggagacaacagcatctacatcaccaagatc
attgaggggggtgctgctcagaaggatggacgcctacagattggggaccggctgctggcg
gtgaacaacaccaatctgcaggatgtgaggcacgaggaagctgtggcctcactgaagaac
acatctgatatggtgtatttgaaggtggccaagccaggcagcctccacctcaacgacatg
tacgctccccctgactacgccagcacttttactgccttggctgacaaccacataagccat
aattccagcctgggttatctcggggctgtggagagcaaggtcagctaccctgctcctcct
caggttccccccacccgctactctcctattcccaggcacatgctggctgaggaggacttc
accagagagcctcgcaagatcatcctgcacaaaggctccacaggcctgggcttcaacatc
gtaggaggagaggatggagaaggcatttttgtctccttcatcctggcaggaggcccagct
gacctgagtggggagctgcgcaggggagaccggatcttatcggtgaatggagtgaatctg
aggaatgcaactcatgagcaggctgcagctgctctgaaacgggccggccagtcagtcacc
attgtggcccagtacagacctgaagaatacagtcgctttgaatcgaagatacatgactta
cgagaacaaatgatgaacagcagcatgagctctgggtctgggtccctccgaacaagtgaa
aagaggtccttgtatgtcagggccctgtttgattatgatcggactcgggacagctgcctg
ccaagccaggggctcagcttctcttatggtgacattctgcatgtcattaatgcctctgat
gatgagtggtggcaggcaaggctggtgaccccacacggagaaagtgagcagatcggtgtg
atccccagtaagaagagggtggaaaagaaagaaagagctcgattgaaaactgtgaagttc
catgccaggacggggatgattgagtctaacagggacttcccggggttaagtgacgattat
tatggagcaaagaacctgaaaggacaagaggatgctattttgtcatatgagccagtgaca
cggcaagaaattcactatgcaaggcctgtgatcatcctgggcccaatgaaggaccgagtc
aatgatgacctgatctccgaatttccacataaatttggatcctgtgtgccacatactacc
cggcctcgacgtgataatgaggtggatggacaagactaccactttgtggtgtcccgagaa
caaatggagaaagatattcaggacaacaagttcatcgaggcgggccaatttaatgataac
ctctatgggaccagcatccagtcagtgcgggcagttgcagagaggggcaagcactgcatc
ttagatgtttccggcaatgctatcaagagactgcagcaagcacaactttaccccattgcc
attttcatcaagcccaagtccattgaagcccttatggaaatgaaccgaaggcagacatat
gaacaagcaaataagatctatgacaaagccatgaaactggagcaggaatttggagagtac
tttacagccattgtacagggtgactcactggaagagatttataacaaaatcaaacaaatc
attgaggaccagtctgggcactacatttgggtcccatcccctgaaaaactctga

DBGET integrated database retrieval system