KEGG   Homo sapiens (human): 1743Help
Entry
1743              CDS       T01001                                 

Gene name
DLST, DLTS
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    1743 (DLST)
  09105 Amino acid metabolism
   00310 Lysine degradation
    1743 (DLST)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     1743 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 DUF4106 GCV_H
Motif
Other DBs
NCBI-GeneID: 1743
NCBI-ProteinID: NP_001924
OMIM: 126063
HGNC: 2911
Ensembl: ENSG00000119689
Vega: OTTHUMG00000171483
Pharos: P36957(Tbio)
UniProt: P36957 A0A024R6C9
Position
14q24.3
AA seq 453 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFF
RTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPI
PTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKE
AQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNA
VIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELA
IEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgatcccgctgtgtgtctcgggcgttcagccgctcgctctccgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgccagggacca
ggttaccctaacagcaggaaggttgtcattaacaacagtgtcttcagtgttcgctttttc
agaactacagctgtatgcaaggatgacttggttacagtcaaaaccccagcgtttgcagaa
tctgtcacagagggagatgtcaggtgggagaaagctgttggagacacagttgcagaagat
gaagtggtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagcaaat
ggcgtgattgaagctcttttggtacctgatgggggaaaagtcgaaggaggcactccactt
ttcacactcaggaaaactggtgctgctcctgctaaggccaagccggctgaagctcctgct
gctgcagccccaaaagcagaacctacagcagcggcagttcctccccctgcagcacccata
cccactcagatgccaccggtgccctcgccctcacagcctccttctggcaaacctgtgtct
gcagtaaaacccactgttgccccaccactagctgagccaggagctggcaaaggtctgcgt
tcagaacatcgggagaaaatgaacaggatgcggcagcgcattgctcagcgtctgaaggag
gcccagaatacatgtgcaatgctgacaacttttaatgagattgacatgagtaacatccag
gagatgagggctcggcacaaagaggcttttttgaagaaacataacctcaaactaggcttc
atgtcggcatttgtgaaggcctcagcctttgccttgcaggaacagcctgttgtaaatgca
gtgattgacgacacaaccaaagaggtggtgtatagggattatattgacatcagtgttgca
gtggccaccccacggggtctggtggttccagtcatcaggaatgtggaagctatgaatttt
gcagatattgaacggaccatcactgaactgggagagaaggcccgaaagaatgaacttgcc
attgaagatatggatggcggtaccttcaccattagcaatggaggcgtttttggctcgctc
tttggaacacccattatcaacccccctcagtctgccatcctggggatgcatggcatcttt
gacaggccagtggctataggaggcaaggtagaggtgcggcccatgatgtacgtggcactg
acctatgatcaccggctgattgatggcagagaggctgtgactttcctccgcaaaatcaag
gcagcggtagaggatcccagagtcctcctcctggatctttag

DBGET integrated database retrieval system