KEGG   Homo sapiens (human): 1746Help
Entry
1746              CDS       T01001                                 

Gene name
DLX2, TES-1, TES1
Definition
(RefSeq) distal-less homeobox 2
  KO
K18488  homeobox protein DLX2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1746 (DLX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Dll
    1746 (DLX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DLL_N Homeobox_KN YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 1746
NCBI-ProteinID: NP_004396
OMIM: 126255
HGNC: 2915
Ensembl: ENSG00000115844
Vega: OTTHUMG00000132276
Pharos: Q07687(Tbio)
UniProt: Q07687 Q53QU7 X5D7D8
Position
2q31.1
AA seq 328 aa AA seqDB search
MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVST
ATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYA
PYGTSSSPANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALP
ERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPAS
WDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLL
HPTQTPQPHHHHHHHGGGGAPVSAGTIF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactggagtctttgacagtctagtggctgatatgcactcgacccagatcgccgcctcc
agcacgtaccaccagcaccagcagcccccgagcggcggcggcgccggcccgggtggcaac
agcagcagcagcagcagcctccacaagccccaggagtcgcccacccttccggtgtccacc
gccaccgacagcagctactacaccaaccagcagcacccggcgggcggcggcggcggcggg
ggctcgccctacgcgcacatgggttcctaccagtaccaagccagcggcctcaacaacgtc
ccttactccgccaagagcagctatgacctgggctacaccgccgcctacacctcctacgct
ccctatggaaccagttcgtccccagccaacaacgagcctgagaaggaggaccttgagcct
gaaattcggatagtgaacgggaagccaaagaaagtccggaaaccccgcaccatctactcc
agtttccagctggcggctcttcagcggcgtttccaaaagactcaatacttggccttgccg
gagcgagccgagctggcggcctctctgggcctcacccagactcaggtcaaaatctggttc
cagaaccgccggtccaagttcaagaagatgtggaaaagtggtgagatcccctcggagcag
caccctggggccagcgcttctccaccttgtgcttcgccgccagtctcagcgccggcctcc
tgggactttggtgtgccgcagcggatggcgggcggcggtggtccgggcagtggcggcagc
ggcgccggcagctcgggctccagcccgagcagcgcggcctcggcttttctgggcaactac
ccctggtaccaccagacctcgggatccgcctcacacctgcaggccacggcgccgctgctg
caccccactcagaccccgcagccgcatcaccaccaccaccatcacggcggcgggggcgcc
ccggtgagcgcggggacgattttctaa

DBGET integrated database retrieval system