KEGG   Homo sapiens (human): 175Help
Entry
175               CDS       T01001                                 

Gene name
AGA, AGU, ASRG, GA
Definition
(RefSeq) aspartylglucosaminidase
  KO
K01444  N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00511  Other glycan degradation
hsa04142  Lysosome
Disease
H00145  Aspartylglucosaminuria
H00422  Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    175 (AGA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    175 (AGA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.26  N4-(beta-N-acetylglucosaminyl)-L-asparaginase
     175 (AGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase_2
Motif
Other DBs
NCBI-GeneID: 175
NCBI-ProteinID: NP_000018
OMIM: 613228
HGNC: 318
Ensembl: ENSG00000038002
Vega: OTTHUMG00000160723
Pharos: P20933(Tbio)
UniProt: P20933
Structure
PDB: 

Position
4q34.3
AA seq 346 aa AA seqDB search
MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESG
CAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCG
PYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPI
PGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF
FGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggaagtcgaacttgcctgtgcttctcgtgccgtttctgctctgccaggcccta
gtgcgctgctccagccctctgcccctggtcgtcaacacttggccctttaagaatgcaacc
gaagcagcgtggagggcattagcatctggaggctctgccctggatgcagtggagagcggc
tgtgccatgtgtgagagagagcagtgtgacggctctgtaggctttggaggaagtcctgat
gaacttggagaaaccacactagatgccatgatcatggatggcactactatggatgtagga
gcagtaggagatctcagacgaattaaaaatgctattggtgtggcacggaaagtactggaa
catacaacacacacacttttagtaggagagtcagccaccacatttgctcaaagtatgggg
tttatcaatgaagacttatctaccactgcttctcaagctcttcattcagattggcttgct
cggaattgccagccaaattattggaggaatgttataccagatccctcaaaatactgcgga
ccctacaaaccacctggtatcttaaagcaggatattcctatccataaagaaacagaagat
gatcgtggtcatgacactattggcatggttgtaatccataagacaggacatattgctgct
ggtacatctacaaatggtataaaattcaaaatacatggccgtgtaggagactcaccaata
cctggagctggagcctatgctgacgatactgcaggggcagccgcagccactgggaatggt
gatatattgatgcgcttcctgccaagctaccaagctgtagaatacatgagaagaggagaa
gatccaaccatagcttgccaaaaagtgatttcaagaatccagaagcattttccagaattc
tttggggctgttatatgtgccaatgtgactggaagttacggtgctgcttgcaataaactt
tcaacatttactcagtttagtttcatggtttataattccgaaaaaaatcagccaactgag
gaaaaagtggactgcatctaa

DBGET integrated database retrieval system