KEGG   Homo sapiens (human): 1759Help
Entry
1759              CDS       T01001                                 

Gene name
DNM1, DNM, EIEE31
Definition
(RefSeq) dynamin 1
  KO
K01528  dynamin GTPase [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05100  Bacterial invasion of epithelial cells
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    1759 (DNM1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1759 (DNM1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1759 (DNM1)
  Nervous system
   04721 Synaptic vesicle cycle
    1759 (DNM1)
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1759 (DNM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     1759 (DNM1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    1759 (DNM1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    1759 (DNM1)
   RhoA-dependent endocytosis
    1759 (DNM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1759 (DNM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 PH_11
Motif
Other DBs
NCBI-GeneID: 1759
NCBI-ProteinID: NP_001275668
OMIM: 602377
HGNC: 2972
Ensembl: ENSG00000106976
Vega: OTTHUMG00000020733
Pharos: Q05193(Tbio)
UniProt: Q05193
Structure
PDB: 

Position
9q34.11
AA seq 864 aa AA seqDB search
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKL
KEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRSGQASPSRPESPRPPFDL
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagatctcatcccgctggtcaaccggctgcaagacgccttc
tctgccatcggccagaacgcggacctcgacctgccgcagatcgctgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtaggcagggacttcttgcctcgagga
tctggcattgtcacccgacgtcccctggtcttgcagctggtcaatgcaaccacagaatat
gccgagttcctgcactgcaagggaaagaaattcaccgacttcgaggaggtgcgccttgag
atcgaggccgagaccgacagggtcaccggcaccaacaagggcatctcgccggtgcctatc
aacctccgcgtctactcgccgcacgtgctgaacctgaccctggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcccgacatcgagttccagatccgagacatgctt
atgcagtttgtcaccaaggagaactgcctcatcctggccgtgtcccccgccaactctgac
ctggccaattctgacgccctcaaggtcgccaaggaggtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctgatggacgagggcacagatgcccgtgatgtgctg
gagaacaagctgctccccctgcgcagaggctacattggagtggtgaaccggagccagaag
gacattgatggcaagaaggacattaccgccgccttggctgctgaacgaaagttcttcctc
tcccatccatcttatcgccacttggctgaccgtatgggcacgccctacctgcagaaggtc
ctcaatcagcaactgacgaaccacatccgggacacactgccggggctgcggaacaagctg
cagagccagctactgtccattgagaaggaggtggaggaatacaagaacttccgccctgat
gacccagctcgcaagaccaaggccctgctgcagatggtccagcagttcgccgtagacttt
gagaagcgcattgagggctcaggagatcagatcgacacctacgaactgtcagggggagcc
cgcattaaccgaatcttccacgagcgcttccctttcgagctggtcaagatggagtttgat
gagaaggaactccgaagggagatcagctatgctatcaagaatatccatggcattaggacg
ggcctcttcacacctgacctcgcttttgaagccacagtgaaaaagcaggtgcagaagctc
aaagagcccagtatcaagtgtgtggatatggtagtcagtgagctcacagccaccatcaga
aagtgtagcgaaaagctccagcagtacccgcggctacgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggccgcactaaggagcaggtcatgcttctcatcgat
atcgagctggcttacatgaacaccaaccatgaggacttcataggctttgccaatgctcag
cagaggagcaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
atccgcaagggctggctgactatcaataatattggcatcatgaaagggggctccaaggag
tactggtttgtgctgactgctgagaatctgtcctggtacaaggatgatgaggagaaagag
aagaaatacatgctgtctgtggacaacctcaagctgcgggacgtggagaagggctttatg
tcgagcaagcatatctttgccctctttaacacggagcagaggaatgtctacaaggattat
cggcagctggagctagcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagggctggcgtgtaccctgagcgtgttggggacaaagagaaagccagcgagaccgag
gagaatggctccgacagcttcatgcattccatggacccacagctggaacggcaagtggag
accatccggaatcttgtggactcatacatggccattgtcaacaagaccgtgagggacctc
atgcccaagaccatcatgcacctcatgattaacaataccaaggagttcatcttctcggag
ctgctggccaacctgtactcgtgtggggaccagaacacgctgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgcactgaaggaggcgctcagc
atcatcggcgacatcaacacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcgcccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccctttcggccctccccctcaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagccgatcgggtcaggcaagtccatcccgtcctgagagccccaggccc
cccttcgacctctaa

DBGET integrated database retrieval system