KEGG   Homo sapiens (human): 176Help
Entry
176               CDS       T01001                                 

Gene name
ACAN, AGC1, AGCAN, CSPG1, CSPGCP, MSK16, SEDK, SSOAOD
Definition
(RefSeq) aggrecan
  KO
K06792  aggrecan 1
Organism
hsa  Homo sapiens (human)
Disease
H00448  Familial osteochondritis dissecans
H00765  Spondyloepiphyseal dysplasia, Kimberley type
H02187  Spondyloepimetaphyseal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    176 (ACAN)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    176 (ACAN)
   04091 Lectins [BR:hsa04091]
    176 (ACAN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   176 (ACAN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   176 (ACAN)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   176 (ACAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C V-set Sushi EGF EGF_2 I-set ig Antimicrobial25
Motif
Other DBs
NCBI-GeneID: 176
NCBI-ProteinID: NP_037359
OMIM: 155760
HGNC: 319
Ensembl: ENSG00000157766
Vega: OTTHUMG00000171989
UniProt: P16112
Position
15q26.1
AA seq 2530 aa AA seqDB search
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF
APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTA
VPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAATEESTEGPSATEV
PSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE
PYTPSPPVPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLD
SSGLTSTVGSGLPVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSG
EVLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL
ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT
APGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPG
VEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVED
ISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISG
LPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPS
GEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEV
LETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSGEVLET
TAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEVVETSA
SGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGLPSGGEGLETSAS
EVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAP
ETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEG
RGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPS
GFPDTSGETSGVTELSGLSSGQPGISGEASGVLYGTSQPFGITDLSGETSGVPDLSGQPS
GLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPS
GEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGSSLPSG
AYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSG
FLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVTLITSE
FVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDISGATPVLPGSGVEVSSVPESS
SETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLTFQEGE
ASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIPES
EWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESESTAAAPA
RSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRET
WVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFEN
WRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFG
QKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPQITCTDPTTYKRRLQKRSSRH
PRRSRPSTAH
NT seq 7593 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttactctgggttttcgtgactctgagggtcatcactgcagctgtcactgta
gaaacttcagaccatgacaactcgctgagtgtcagcatcccccaaccgtccccgctgagg
gtcctcctggggacctccctcaccatcccctgctatttcatcgaccccatgcaccctgtg
accaccgccccttctaccgccccactggccccaagaatcaagtggagccgtgtgtccaag
gagaaggaggtagtgctgctggtggccactgaagggcgcgtgcgggtcaacagtgcctat
caggacaaggtctcactgcccaactacccggccatccccagtgacgccaccttggaagtc
cagagcctgcgctccaatgactctggggtctaccgctgcgaggtgatgcatggcatcgag
gacagcgaggccaccctggaagtcgtggtgaaaggcatcgtgttccattacagagccatc
tctacacgctacaccctcgactttgacagggcgcagcgggcctgcctgcagaacagtgcc
atcattgccacgcctgagcagctgcaggccgcctacgaagacggcttccaccagtgtgac
gccggctggctggctgaccagactgtcagataccccatccacactccccgggaaggctgc
tatggagacaaggatgagtttcctggtgtgaggacgtatggcatccgagacaccaacgag
acctatgatgtgtactgcttcgccgaggagatggagggtgaggtcttttatgcaacatct
ccagagaagttcaccttccaggaagcagccaatgagtgccggcggctgggtgcccggctg
gccaccacgggccagctctacctggcctggcaggctggcatggacatgtgcagcgccggc
tggctggccgaccgcagcgtgcgctaccccatctccaaggcccggcccaactgcggtggc
aacctcctgggcgtgaggaccgtctacgtgcatgccaaccagacgggctaccccgacccc
tcatcccgctacgacgccatctgctacacaggtgaagactttgtggacatcccagaaaac
ttctttggagtggggggtgaggaggacatcaccgtccagacagtgacctggcctgacatg
gagctgccactgcctcgaaacatcactgagggtgaagcccgaggcagcgtgatccttacc
gtaaagcccatcttcgaggtctcccccagtcccctggaacccgaggagcccttcacgttt
gcccctgaaataggggccactgccttcgctgaggttgagaatgagactggagaggccacc
aggccctggggctttcccacacctggcctgggccctgccacggcattcaccagtgaggac
ctcgtcgtgcaggtgaccgctgtccctgggcagccgcatttgccagggggggtcgtcttc
cactaccgcccgggacccacccgctactcgctgacctttgaggaggcacagcaggcctgc
ctgcgcacgggggcggtcattgcctcgccggagcagctccaggccgcctacgaagcaggc
tatgagcagtgtgacgccggctggctgcgggaccagaccgtcagataccccattgtgagc
ccccggaccccatgcgtgggtgacaaggacagcagcccaggggtcaggacctatggcgtg
cgcccatcaacagagacctacgatgtctactgctttgtagacagacttgagggggaggtg
ttcttcgccacacgccttgagcagttcaccttccaggaagcactggagttctgtgaatct
cacaatgctacgctggccaccacgggccagctctacgccgcctggagccgcggcctggac
aagtgctatgccggctggctggccgacggcagcctccgctaccccatcgtcaccccaagg
cctgcctgcggtggggacaagccaggcgtgagaacggtctacctctaccctaaccagacg
ggcctcccagacccactgtcccggcaccatgccttctgcttccgaggcatttcagcggtt
ccttctccaggagaagaagagggtggcacacccacatcaccctctggtgtggaggagtgg
atcgtgacccaagtggttcctggtgtggctgctgtccccgtagaagaggagacaactgct
gtaccctcaggggagactactgccatcctagagttcaccaccgagccagaaaaccagaca
gaatgggaaccagcctataccccagtgggcacatccccgctgccagggatccttcctact
tggcctcccactggcgcagcaacagaggaaagtacagaaggcccttctgcaactgaagtg
ccctctgcctcagaggaaccatccccctcagaggtgccattcccctcagaggagccatcc
ccctcagaggaaccattcccctcagtgaggccattcccctcagtggagctgttcccctca
gaggagccattcccctccaaggagccatccccctcagaggaaccatcagcctcggaagag
ccgtatacaccttcaccccccgtgcccagctggactgagctgcccagctctggggaggaa
tctggggcccctgatgtcagtggtgacttcacaggcagtggagatgtttcaggacacctt
gacttcagtgggcagctgtcaggggacagggcaagtggactgccctctggagacctggac
tccagtggtcttacttccacagtgggctcaggcctgcctgtggaaagtggactaccctca
ggggatgaagagagaattgagtggcccagcactcctacggttggtgaactgccctctgga
gctgagatcctagagggctctgcctctggagttggggatctcagtggacttccttctgga
gaagttctagagacctctgcctctggagtaggagacctcagtgggcttccttctggagaa
gttctagagaccactgcccctggagtagaggacatcagcgggcttccttctggagaagtt
ctagagaccactgcccctggagtagaggacatcagcgggcttccttctggagaagttcta
gagaccactgcccctggagtagaggacatcagcgggcttccttctggagaagttctagag
accactgcccctggagtagaggacatcagcgggcttccttctggagaagttctagagacc
actgcccctggagtagaggacatcagcgggcttccttctggagaagttctagagaccact
gcccctggagtagaggacatcagcgggcttccttctggagaagttctagagaccgctgcc
cctggagtagaggacatcagcgggcttccttctggagaagttctagagaccgctgcccct
ggagtagaggacatcagcgggcttccttctggagaagttctagagaccgctgcccctgga
gtagaggacatcagcgggcttccttctggagaagttctagagaccgctgcccctggagta
gaggacatcagcgggcttccttctggagaagttctagagaccgctgcccctggagtagag
gacatcagcgggcttccttctggagaagttctagagaccgctgcccctggagtagaggac
atcagcgggcttccttctggagaagttctagagaccgctgcccctggagtagaggacatc
agcgggcttccttctggagaagttctagagactgctgcccctggagtagaggacatcagc
gggcttccttctggagaagttctagagactgctgcccctggagtagaggacatcagcggg
cttccttctggagaagttctagagactgctgcccctggagtagaggacatcagcgggctt
ccttctggagaagttctagagactgctgcccctggagtagaggacatcagcgggcttcct
tctggagaagttctagagactgctgcccctggagtagaggacatcagcgggcttccttct
ggagaagttctagagactgctgcccctggagtagaggacatcagcgggcttccttctgga
gaagttctagagactgctgcccctggagtagaggacatcagcgggcttccttctggagaa
gttctagagactgctgcccctggagtagaggacatcagcgggcttccttctggagaagtt
ctagagactgctgcccctggagtagaggacatcagcgggcttccttctggagaagttcta
gagactactgcccctggagtagaggagatcagcgggcttccttctggagaagttctagag
actactgcccctggagtagatgagatcagtgggcttccttctggagaagttctagagact
actgcccctggagtagaggagatcagcgggcttccttctggagaagttctagagacttct
acctctgcggtaggggacctcagtggacttccttctggaggagaagttctagagatttct
gtctctggagtagaggacatcagtgggcttccttctggagaggttgtagagacttctgcc
tctggaatagaggatgtcagtgaacttccttcaggagaaggtctagagacctctgcttct
ggagtagaggacctcagcaggctcccttctggagaagaagttctagagatttctgcctct
ggatttggggacctcagtggacttccttctggaggagaaggtctagagacctctgcttct
gaagtagggactgacctcagtgggcttccttctggaagggagggtctagagacttcagct
tctggagctgaggacctcagtgggttgccttctggaaaagaagacttggtggggtcagct
tctggagacttggacttgggcaaactgccttctggaactctaggaagtgggcaagctcca
gaaacaagtggtcttccctctggatttagtggtgagtattctggggtggaccttggaagt
ggcccaccctctggcctgcctgactttagtggacttccatctggattcccaactgtttcc
ctagtggattctacattggtggaagtggtcacagcctccactgcaagtgaactggaaggg
aggggaaccattggcatcagtggtgcaggagaaatatctggactgccctccagtgagctg
gacattagtgggagagctagtggactcccttcaggaactgaactcagtggccaagcatct
gggtctcctgatgtcagtggggaaatacctggactctttggtgtcagtggacagccatca
gggtttcctgacactagtggggaaacatctggagtgactgagcttagcgggctgtcctct
ggacaaccaggtattagtggagaagcatctggagttctttatggcactagtcaacccttt
ggcataactgatctgagtggagaaacatctggggtccctgatctcagtgggcagccttca
gggttaccagggttcagtggggcaacatcaggagtccctgacctggtttctggtaccacg
agtggcagcggtgaatcttctgggattacatttgtggacaccagtttggttgaagtggcc
cctactacatttaaagaagaagaaggcttagggtctgtggaactcagtggcctcccttcc
ggagaggcagatctgtcaggcaaatctgggatggtggatgtcagtggacagttttctgga
acagtcgattccagtgggtttacatcccagactccggaattcagtggcctaccaagtggc
atagctgaggtcagtggagaatcctccagagctgagattgggagcagcctgccctcggga
gcatattatggcagtggaactccatctagtttccccactgtctctcttgtagacagaact
ttggtggaatctgtaacccaggctccaacagcccaagaggcaggagaagggccttctggc
attttagaactcagtggtgctcattctggagcaccagacatgtctggggagcattctgga
tttctggacctaagtgggctgcagtccgggctgatagagcccagcggagagccaccaggt
actccatattttagtggggattttgccagcaccaccaatgtaagtggagaatcctctgta
gccatgggcaccagtggagaggcctcaggacttccagaagttactttaatcacttctgag
ttcgtggagggtgttactgaaccaactatttctcaggaactaggccaaaggccccctgtg
acacacacaccccagctttttgagtccagtggaaaagtctccacagctggggacattagt
ggagctaccccagtgctccctgggtctggagtagaagtatcatcagtcccagaatctagc
agtgagacgtccgcctatcctgaagctgggttcggggcatctgccgcccctgaggccagc
agagaagattctgggtcccctgatctgagtgaaaccacctctgcattccacgaagctaac
cttgagagatcctctggcctaggagtgagcggcagcactttgacatttcaagaaggcgag
gcgtccgctgccccagaagtgagtggagaatccaccaccaccagtgatgtggggacagag
gcaccaggcttgccttcagccactcccacggcttctggagacaggactgaaatcagcgga
gacctgtctggtcacacctcgcagctgggcgttgtcatcagcaccagcatcccagagtct
gagtggacccagcagacccagcgccctgcagagacgcatctagaaattgagtcctcaagc
ctcctgtactcaggagaagagactcacacagtcgaaacagccacctccccaacagatgct
tccatcccagcttctccggaatggaaacgtgaatcagaatcaactgctgcagcccccgcc
aggtcctgtgcagaggagccctgtggagctgggacctgcaaggagacagagggacacgtc
atatgcctgtgcccccctggctacactggcgagcactgtaacatagaccaggaggtatgt
gaggagggctggaacaagtaccagggccactgttaccgccacttcccggaccgcgagacc
tgggtggatgctgagcgccggtgtcgggagcagcagtcacacctgagcagcatcgtcacc
cccgaggagcaggagtttgtcaacaacaatgcccaagactaccagtggatcggcctgaac
gacaggaccatcgaaggggacttccgctggtcagatggacaccccatgcaatttgagaac
tggcgccccaaccagcctgacaacttttttgccgctggagaggactgtgtggtgatgatc
tggcacgagaagggcgagtggaatgatgttccctgcaattaccacctccccttcacgtgt
aaaaagggcacagtggcctgcggagagccccctgtggtggagcatgccaggaccttcggg
cagaagaaggaccggtatgagatcaattccctggtgcggtaccagtgcacagaggggttt
gtccagcgccacatgcccaccatccggtgccagcccagcgggcactgggaggagcctcag
atcacctgcacagaccccaccacctacaaacgcagactacagaagcggagctcacggcac
cctcggaggagccgccccagcacagcccactga

DBGET integrated database retrieval system