KEGG   Homo sapiens (human): 1760Help
Entry
1760              CDS       T01001                                 

Gene name
DMPK, DM, DM1, DM1PK, DMK, MDPK, MT-PK
Definition
(RefSeq) DM1 protein kinase
  KO
K08788  dystrophia myotonica-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00568  Myotonic dystrophy
Drug target
Baliforsen: D10907
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1760 (DMPK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1760 (DMPK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   1760 (DMPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DMPK_coil Kinase-like FTA2 Kdo Haspin_kinase AP_endonuc_2 Laminin_II DUF3450 Seadorna_VP7 Tmemb_cc2 ATG16
Motif
Other DBs
NCBI-GeneID: 1760
NCBI-ProteinID: NP_004400
OMIM: 605377
HGNC: 2933
Ensembl: ENSG00000104936
Vega: OTTHUMG00000182334
Pharos: Q09013(Tchem)
UniProt: Q09013 E5KR06
Structure
PDB: 

Position
19q13.32
AA seq 629 aa AA seqDB search
MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVR
LKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREER
DVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIV
MAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSP
EILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLP
LVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEG
ATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVL
TRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPS
PRATDPPSHLDGPPAVAVGQCPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSR
AAALGCIGLVAHAGQLTAVWRRPGAARAP
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgaggtgcggctgaggcggctccagcagctggtgttggacccgggcttcctg
gggctggagcccctgctcgaccttctcctgggcgtccaccaggagctgggcgcctccgaa
ctggcccaggacaagtacgtggccgacttcttgcagtgggcggagcccatcgtggtgagg
cttaaggaggtccgactgcagagggacgacttcgagattctgaaggtgatcggacgcggg
gcgttcagcgaggtagcggtagtgaagatgaagcagacgggccaggtgtatgccatgaag
atcatgaacaagtgggacatgctgaagaggggcgaggtgtcgtgcttccgtgaggagagg
gacgtgttggtgaatggggaccggcggtggatcacgcagctgcacttcgccttccaggat
gagaactacctgtacctggtcatggagtattacgtgggcggggacctgctgacactgctg
agcaagtttggggagcggattccggccgagatggcgcgcttctacctggcggagattgtc
atggccatagactcggtgcaccggcttggctacgtgcacagggacatcaaacccgacaac
atcctgctggaccgctgtggccacatccgcctggccgacttcggctcttgcctcaagctg
cgggcagatggaacggtgcggtcgctggtggctgtgggcaccccagactacctgtccccc
gagatcctgcaggctgtgggcggtgggcctgggacaggcagctacgggcccgagtgtgac
tggtgggcgctgggtgtattcgcctatgaaatgttctatgggcagacgcccttctacgcg
gattccacggcggagacctatggcaagatcgtccactacaaggagcacctctctctgccg
ctggtggacgaaggggtccctgaggaggctcgagacttcattcagcggttgctgtgtccc
ccggagacacggctgggccggggtggagcaggcgacttccggacacatcccttcttcttt
ggcctcgactgggatggtctccgggacagcgtgcccccctttacaccggatttcgaaggt
gccaccgacacatgcaacttcgacttggtggaggacgggctcactgccatggtgagcggg
ggcggggagacactgtcggacattcgggaaggtgcgccgctaggggtccacctgcctttt
gtgggctactcctactcctgcatggccctcagggacagtgaggtcccaggccccacaccc
atggaactggaggccgagcagctgcttgagccacacgtgcaagcgcccagcctggagccc
tcggtgtccccacaggatgaaacagctgaagtggcagttccagcggctgtccctgcggca
gaggctgaggccgaggtgacgctgcgggagctccaggaagccctggaggaggaggtgctc
acccggcagagcctgagccgggagatggaggccatccgcacggacaaccagaacttcgcc
agtcaactacgcgaggcagaggctcggaaccgggacctagaggcacacgtccggcagttg
caggagcggatggagttgctgcaggcagagggagccacagctgtcacgggggtccccagt
ccccgggccacggatccaccttcccatctagatggccccccggccgtggctgtgggccag
tgcccgctggtggggccaggccccatgcaccgccgccacctgctgctccctgccagggtc
cctaggcctggcctatcggaggcgctttccctgctcctgttcgccgttgttctgtctcgt
gccgccgccctgggctgcattgggttggtggcccacgccggccaactcaccgcagtctgg
cgccgcccaggagccgcccgcgctccctga

DBGET integrated database retrieval system