KEGG   Homo sapiens (human): 177Help
Entry
177               CDS       T01001                                 

Gene name
AGER, RAGE, SCARJ1
Definition
(RefSeq) advanced glycosylation end-product specific receptor
  KO
K19722  receptor for advanced glycosylation end products
Organism
hsa  Homo sapiens (human)
Pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    177 (AGER)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 Ig_3 Ig_2 I-set ig V-set Ig_4 Ig_5
Motif
Other DBs
NCBI-GeneID: 177
NCBI-ProteinID: NP_001127
OMIM: 600214
HGNC: 320
Ensembl: ENSG00000204305
Vega: OTTHUMG00000031120
Pharos: Q15109(Tchem)
UniProt: Q15109 A0A1U9X785 B4DNX3
Structure
PDB: 

Position
6p21.32
AA seq 404 aa AA seqDB search
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctgccggaacagcagttggagcctgggtgctggtcctcagtctgtggggggcagta
gtaggtgctcaaaacatcacagcccggattggcgagccactggtgctgaagtgtaagggg
gcccccaagaaaccaccccagcggctggaatggaaactgaacacaggccggacagaagct
tggaaggtcctgtctccccagggaggaggcccctgggacagtgtggctcgtgtccttccc
aacggctccctcttccttccggctgtcgggatccaggatgaggggattttccggtgccag
gcaatgaacaggaatggaaaggagaccaagtccaactaccgagtccgtgtctaccagatt
cctgggaagccagaaattgtagattctgcctctgaactcacggctggtgttcccaataag
gtggggacatgtgtgtcagagggaagctaccctgcagggactcttagctggcacttggat
gggaagcccctggtgcctaatgagaagggagtatctgtgaaggaacagaccaggagacac
cctgagacagggctcttcacactgcagtcggagctaatggtgaccccagcccggggagga
gatccccgtcccaccttctcctgtagcttcagcccaggccttccccgacaccgggccttg
cgcacagcccccatccagccccgtgtctgggagcctgtgcctctggaggaggtccaattg
gtggtggagccagaaggtggagcagtagctcctggtggaaccgtaaccctgacctgtgaa
gtccctgcccagccctctcctcaaatccactggatgaaggatggtgtgcccttgcccctt
ccccccagccctgtgctgatcctccctgagatagggcctcaggaccagggaacctacagc
tgtgtggccacccattccagccacgggccccaggaaagccgtgctgtcagcatcagcatc
atcgaaccaggcgaggaggggccaactgcaggctctgtgggaggatcagggctgggaact
ctagccctggccctggggatcctgggaggcctggggacagccgccctgctcattggggtc
atcttgtggcaaaggcggcaacgccgaggagaggagaggaaggccccagaaaaccaggag
gaagaggaggagcgtgcagaactgaatcagtcggaggaacctgaggcaggcgagagtagt
actggagggccttga

DBGET integrated database retrieval system