KEGG   Homo sapiens (human): 1777
Entry
1777              CDS       T01001                                 
Symbol
DNASE2, AIPCS, DNASE2A, DNL, DNL2
Name
(RefSeq) deoxyribonuclease 2, lysosomal
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1777 (DNASE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     1777 (DNASE2)
SSDB
Motif
Pfam: DNase_II
Other DBs
NCBI-GeneID: 1777
NCBI-ProteinID: NP_001366
OMIM: 126350
HGNC: 2960
Ensembl: ENSG00000105612
Pharos: O00115(Tbio)
UniProt: O00115 A0A024R7F4
Position
19:complement(12875209..12881449)
AA seq 360 aa
MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGG
WRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLL
DHDGGFWLVHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPW
VYNYQLEGIFAQEFPDLENVVKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYS
GWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV
SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgatcccgctgctgctggcagcgctgctgtgcgtccccgccggggccctgacctgctac
ggggactccgggcagcctgtagactggttcgtggtctacaagctgccagctcttagaggg
tccggggaggcggcgcagagagggctgcagtacaagtatctggacgagagctccggaggc
tggcgggacggcagggcactcatcaacagcccggagggggccgtgggccgaagcctgcag
ccgctgtaccggagcaacaccagccagctcgccttcctgctctacaatgaccaaccgcct
caacccagcaaggctcaggactcttccatgcgtgggcacacgaagggtgtcctgctcctt
gaccacgatgggggcttctggctggtccacagtgtacctaacttccctccaccggcctcc
tctgctgcatacagctggcctcatagcgcctgtacctacgggcagaccctgctctgtgtg
tcttttcccttcgctcagttctcgaagatgggcaagcagctgacctacacctacccctgg
gtctataactaccagctggaagggatctttgcccaggaattccccgacttggagaatgtg
gtcaagggccaccacgttagccaagaaccctggaacagcagcatcacactcacatcccag
gccggggctgttttccagagctttgccaagttcagcaaatttggagatgacctgtactcc
ggctggttggcagcagcccttggtaccaacctgcaggtccagttctggcacaaaactgta
ggcatcctgccctctaactgctcggatatctggcaggttctgaatgtgaaccagatagct
ttccctggaccagccggcccaagcttcaacagcacagaggaccactccaaatggtgcgtg
tccccaaaagggccctggacctgcgtgggtgacatgaatcggaaccagggagaggagcaa
cggggtgggggcacactgtgtgcccagctgccagccctctggaaagccttccagccgctg
gtgaagaactaccagccctgtaatggcatggccaggaagcccagcagagcttataagatc
taa

DBGET integrated database retrieval system