KEGG   Homo sapiens (human): 1780Help
Entry
1780              CDS       T01001                                 

Gene name
DYNC1I1, DNCI1, DNCIC1
Definition
(RefSeq) dynein cytoplasmic 1 intermediate chain 1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1780 (DYNC1I1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1780 (DYNC1I1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    1780 (DYNC1I1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1780 (DYNC1I1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1780 (DYNC1I1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      1780 (DYNC1I1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     1780 (DYNC1I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynein_IC2 WD40
Motif
Other DBs
NCBI-GeneID: 1780
NCBI-ProteinID: NP_004402
OMIM: 603772
HGNC: 2963
Ensembl: ENSG00000158560
Vega: OTTHUMG00000153983
Pharos: O14576(Tbio)
UniProt: O14576 A4D1I7 Q8N542
Position
7q21.3
AA seq 645 aa AA seqDB search
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaagtgacttaaaagctgagctagagcgcaaaaagcagcgcttagcacag
ataagagaagagaagaaacggaaggaagaggagaggaaaaagaaagaggctgatatgcag
cagaagaaagaacccgttcaggacgactctgatctggatcgcaaacgacgagagacagag
gctttgctgcaaagcattggtatctcaccggagccgcctctagtgcagccgctgcatttt
ttaacatgggatacctgttattttcattatttagtcccaacccctatgtctccctcctcg
aaatcagtgagcactcccagtgaagctggaagccaagactcaggcgatctggggccatta
acaaggaccctgcagtgggacacagacccctcagtgctccagctgcagtcagactcagaa
cttggaagaagactgcataaactgggcgtgtcaaaggtcacccaagtggatttcctgcca
agggaagtagtgtcctactcaaaggagacccagactcctcttgccacgcatcagtctgaa
gaggatgaggaagatgaggaaatggtggaatctaaagttggccaggactcagaactggaa
aatcaggacaaaaaacaggaagtgaaggaagcccctccaagagagttgacagaggaagaa
aaacagcagatccttcattcagaggaatttctcatcttttttgaccggacaatacgggta
attgaaagagccctggctgaagattccgacatcttttttgactacagcggccgagagtta
gaggaaaaagatggggatgttcaggctggagccaatctttctttcaatcgtcagttctat
gatgaacattggtccaagcatcgagtggtcacttgtatggactggtccctccagtaccct
gagctgatggtggcttcttacaacaacaatgaagatgctccccatgaaccagatggagtg
gccttggtttggaacatgaagtttaagaaaaccacaccagaatacgtcttccactgtcag
tcctctgtgatgtcggtctgcttcgcccgtttccatcctaacttggtggttggtgggact
tactcgggccagattgtcctctgggacaatcgcagtcatcgaaggactccagtgcagcgg
acacccttatcagctgctgcacacacgcatcccgtgtactgtgtaaatgttgttgggacc
cagaatgctcataacctcatcactgtctccactgatggcaaaatgtgttcctggagcctg
gacatgctctcaactccacaggagagcatggagctggtgtacaataagtccaagcctgtc
gctgttaccggaatggctttcccaacgggagacgtcaataacttcgtggttggcagtgag
gaaggtacagtctacacggcttgtcgtcatggaagcaaagcaggtattggtgaggtcttt
gaaggtcaccaagggccagtgacaggaattaactgccacatggcagtgggcccaatcgac
ttttctcacctgtttgtcacatcatcatttgactggactgtcaaactgtggaccaccaag
cacaacaagccgctctactcctttgaagacaatgcagactatgtgtacgatgtcatgtgg
tcccccgtgcatcctgcgctttttgcctgcgtggacgggatggggcgcttggacctctgg
aacctcaacaatgacaccgaggttccaacagcaagtgtggccattgagggggcatccgcc
ctaaaccgtgttcgttgggcccaagctggcaaagaagttgctgttggggactcggaaggc
cgtatttgggtctatgacgttggagagcttgcagttccccacaatgatgaatggacccga
tttgccaggacccttgtggaaattcgtgctaacagagctgatagcgaggaggaaggcact
gttgagttatctgcctag

DBGET integrated database retrieval system