KEGG   Homo sapiens (human): 1781
Entry
1781              CDS       T01001                                 

Gene name
DYNC1I2, DIC74, DNCI2, IC2, NEDMIBA
Definition
(RefSeq) dynein cytoplasmic 1 intermediate chain 2
  KO
K10415  dynein intermediate chain, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01295  Rab7-regulated microtubule minus-end directed transport
Disease
H02461  Neurodevelopmental disorder with microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1781 (DYNC1I2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1781 (DYNC1I2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1781 (DYNC1I2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1781 (DYNC1I2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1781 (DYNC1I2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      1781 (DYNC1I2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     1781 (DYNC1I2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 1781
NCBI-ProteinID: NP_001258714
OMIM: 603331
HGNC: 2964
Ensembl: ENSG00000077380
Vega: OTTHUMG00000154061
Pharos: Q13409(Tbio)
UniProt: Q13409 A0A140VKE9
Structure
PDB: 
6F1U 6F1Z 6F1T 6F38 6F3A

Position
2q31.1
AA seq 638 aa
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVFSEYWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDP
SVLQLHSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVA
PKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQ
INIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYN
NNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLW
DNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQD
SMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPIT
GIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALF
ACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVG
EQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgtcagacaaaagtgaattaaaggctgagttggaacgtaagaagcagcgactggcccaa
atcagagaggaaaagaagagaaaagaagaagaaaggaaaaaaaaagaaacagaccagaag
aaggaagctgttgctcctgtgcaagaagaatcagatcttgaaaaaaaaaggagagaagct
gaagcattgcttcaaagcatggggctaactccagaatcccccattgttttttctgaatac
tgggtccctcctcctatgtctccatcctccaaatctgtgagcactccaagtgaagctgga
agccaagactctggagatggcgccgtgggatctaggacgctgcattgggatacagatcca
tcagttcttcagcttcactcagattccgatttgggacgaggacctattaaacttggaatg
gctaaaatcacgcaagtcgactttcctcctcgagaaattgtcacgtatacaaaggaaact
cagactccagttatggctcaacccaaagaagatgaagaggaagatgatgatgtagtggct
cctaaaccacctattgaacctgaagaagagaaaactttaaagaaagatgaggaaaatgat
agtaaagctccccctcatgagctgactgaagaagaaaagcaacaaatcttgcactctgag
gaatttttaagtttctttgaccattctacaagaattgtagaaagagctctttctgagcag
attaacatcttctttgactatagtgggagagatttggaagacaaagaaggagagattcaa
gcaggtgctaaactgtcattaaatcgacaattttttgacgaacgttggtcaaagcatcgg
gtggttagttgtttggattggtcatctcagtatccggagttactcgtggcttcctataac
aacaatgaagatgcccctcatgagcctgatggtgtggcccttgtatggaatatgaaatac
aaaaaaactaccccagagtatgtgtttcactgccagtcagctgtgatgtctgccacattt
gcaaaatttcatccaaatcttgttgttggtggtacatattcaggccaaattgtgctttgg
gataaccgtagcaataaaagaactccagtgcaaagaactccactgtcagcagctgcacac
acacaccctgtatattgtgtaaatgttgttggaacacaaaatgctcacaatctgattagc
atctctactgatggaaaaatttgttcatggagtctggacatgctttcccatccacaggat
agcatggagttggttcataaacagtcaaaagcagtagctgtgacatctatgtccttccct
gttggagatgtcaacaactttgttgttgggagtgaagaaggttctgtgtacacagcatgc
cgccatggcagcaaagctggaatcagtgagatgtttgaggggcatcaaggaccaatcact
ggcatccattgtcatgcagctgttggagcagtagacttctcacatctttttgtcacttca
tcgtttgactggacagtaaagctttggacaactaagaataacaagcctttgtattcattt
gaagataatgcagactatgtttatgatgttatgtggtcacctacccacccagccctgttt
gcctgtgtggatggcatggggagattggatttgtggaatctcaataatgacacagaggta
ccaactgccagcatttctgtggagggtaatcctgctcttaatcgtgtgagatggacccat
tctggcagagagattgctgtgggtgattctgaaggacagattgttatatacgatgtggga
gagcagattgctgttccccgcaatgatgaatgggcacggtttggccgaacacttgcagaa
attaatgcaaaccgagctgatgcagaggaggaagcagctacccgaatacctgcttag

DBGET integrated database retrieval system