KEGG   Homo sapiens (human): 1793Help
Entry
1793              CDS       T01001                                 

Gene name
DOCK1, DOCK180, ced5
Definition
(RefSeq) dedicator of cytokinesis 1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1793 (DOCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1793 (DOCK1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05131 Shigellosis
    1793 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    1793 (DOCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1793 (DOCK1)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    1793 (DOCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_9 SH3_1 SH3_2 SR-25
Motif
Other DBs
NCBI-GeneID: 1793
NCBI-ProteinID: NP_001371
OMIM: 601403
HGNC: 2987
Ensembl: ENSG00000150760
Vega: OTTHUMG00000019249
Pharos: Q14185(Tbio)
UniProt: Q14185 A0A2X0U2H5 B2RUU3
Structure
PDB: 

Position
10q26.2
AA seq 1865 aa AA seqDB search
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVD
SGIVQ
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttacgaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaacatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcattccctttcagccggtggcaggggagaatgacttc
cttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaaggggcagggt
ttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagtttccg
catttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatcatg
cctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaagga
agcaaaacaacagcgaagaacgtggaggtcacggtgtctgtgtacgatgaggatgggaaa
cgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaatct
gtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccattccc
atcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcacaggac
tctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatacgat
ggtaccaccctgcgagacggagagcacgatcttatcgtctataaggccgaagcaaagaag
ctggaagatgctgccacgtacttgagtctgccctccacgaaggcagagttggaagaaaag
ggccactcggccaccggcaagagcatgcagagccttgggagctgcaccattagcaaggac
tccttccagatctccacgctcgtgtgctccaccaaactgactcagaacgtggaccttctg
gggctcttgaaatggcgctccaacaccagcctgctgcagcagaacttgaggcagctgatg
aaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttcaac
atcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctggta
tttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaaact
tacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttgaag
aactacgtggacggtgctgagaagccgggagtaaatgagcagctgtacaaagccatgaaa
gcgctagaatccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactgtat
gaaaacaagggagaggctgacttcgtggaatctttgctgcagctcttcaggtccatcaat
gacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaatac
ttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaaatg
tttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctactgc
ttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctgctt
cccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcctgc
tgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaacccag
aggcacgtccagattatcatggagaaacttctccggaccgtgaaccgaaccgtcatttcc
atgggacgagattctgaactcattggaaacttcgtggcttgcatgacagctattttacga
caaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggactgat
gtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaacgtt
taccccttcgactgggtgatcatgaacatggtgcaaaataaagtcttcctgcgagcaatt
aatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagctacag
ctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaactg
gagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgaggaga
cagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaagttc
attccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctgcgc
aaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccgaagc
ttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggcaga
ggagacgaacagtacaaagtgttatttgataaaatccttctggaacactgcaggaagcac
aaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaaagg
cttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgcacc
gtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtatttg
tacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcggcttacaccttg
cttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacccag
cgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaggaaatc
atccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggagcta
gccgagcagtatgagaacgaaatgtttgattatgagcaactcagcgaattgctgaaaaaa
caggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgactattttgct
gttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttaccga
gggaaagagtatgagcgccgggaagattttgaggctcggctcttaactcagtttccaaac
gccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactctcctggccag
tatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacaggcca
gtgtcagagcagattgtaagtttttacagggtgaacgaggtccagcgatttgaatattct
cggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatcgag
agaaccatatatacaactgcatataaattacctggaattttaaggtggtttgaggtcaag
tctgttttcatggtggaaatcagccccctggagaatgccattgagaccatgcagctgacg
aacgacaagatcaacagcatggtgcagcagcacctggatgaccccagcctgcccatcaac
ccgctctccatgctcctgaacggcatcgtggacccagctgtcatggggggcttcgcaaac
tacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaaaag
atcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatcaga
atccatggagacaaagtcacggaggcactgaggccgttccacgagaggatggaggcctgt
ttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctcaagt
ctggatgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgccttcc
tcatcccgccctctgtctgtggcctctgtctcttccctctcatcggacagcaccccttcc
agaccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactccagg
tcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaaggaa
aaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatttcc
ctgcagcagtctgaggctgtgatcctttcggaaacgataagtcccctgcggccccagaga
ccgaagagccaggtgatgaacgtcattggaagcgaaaggcgcttctcggtgtccccctcg
tcaccgtcctcccagcaaacaccccctccagttacaccaagggccaagctcagcttcagc
atgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtcccaccc
cctctgcctctcaaaggcagcgtggcagattacgggaatttgatggaaaaccaggacttg
ctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctccactg
cccagcaaaactccgcctcctccccctccaaagacaactcgcaagcagacatcggtggac
tccgggatcgtgcagtga

DBGET integrated database retrieval system