KEGG   Homo sapiens (human): 1803
Entry
1803              CDS       T01001                                 

Gene name
DPP4, ADABP, ADCP2, CD26, DPPIV, TP103
Definition
(RefSeq) dipeptidyl peptidase 4
  KO
K01278  dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Drug target
Alogliptin: D06553<JP/US>
Anagliptin: D09780<JP>
Carmegliptin (DG01281): D08631 D09326
Denagliptin tosylate: D06578
Dutogliptin (DG01282): D09333 D09334
Evogliptin: D11023
Gemigliptin: D10502
Gosogliptin: D09625
Linagliptin: D09566<JP/US>
Omarigliptin: D10317<JP>
Saxagliptin (DG00119): D08996 D09753<JP> D10262<US>
Sitagliptin (DG00118): D06645<JP/US> D08516
Teneligliptin (DG01283): D08616 D09756<JP> D11968
Trelagliptin (DG01284): D10178 D10179<JP>
Vildagliptin: D07080<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1803 (DPP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1803 (DPP4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1803 (DPP4)
   04090 CD molecules [BR:hsa04090]
    1803 (DPP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     1803 (DPP4)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   1803 (DPP4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1803 (DPP4)
  Exosomal proteins of epithelial cells
   1803 (DPP4)
  Exosomal proteins of colorectal cancer cells
   1803 (DPP4)
CD molecules [BR:hsa04090]
 Proteins
  1803 (DPP4)
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 DPPIV_rep DLH LIP Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S15
Other DBs
NCBI-GeneID: 1803
NCBI-ProteinID: NP_001926
OMIM: 102720
HGNC: 3009
Ensembl: ENSG00000197635
Vega: OTTHUMG00000132056
Pharos: P27487(Tclin)
UniProt: P27487
Structure
PDB: 

Position
2q24.2
AA seq 766 aa
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgaagacaccgtggaaggttcttctgggactgctgggtgctgctgcgcttgtcaccatc
atcaccgtgcccgtggttctgctgaacaaaggcacagatgatgctacagctgacagtcgc
aaaacttacactctaactgattacttaaaaaatacttatagactgaagttatactcctta
agatggatttcagatcatgaatatctctacaaacaagaaaataatatcttggtattcaat
gctgaatatggaaacagctcagttttcttggagaacagtacatttgatgagtttggacat
tctatcaatgattattcaatatctcctgatgggcagtttattctcttagaatacaactac
gtgaagcaatggaggcattcctacacagcttcatatgacatttatgatttaaataaaagg
cagctgattacagaagagaggattccaaacaacacacagtgggtcacatggtcaccagtg
ggtcataaattggcatatgtttggaacaatgacatttatgttaaaattgaaccaaattta
ccaagttacagaatcacatggacggggaaagaagatataatatataatggaataactgac
tgggtttatgaagaggaagtcttcagtgcctactctgctctgtggtggtctccaaacggc
acttttttagcatatgcccaatttaacgacacagaagtcccacttattgaatactccttc
tactctgatgagtcactgcagtacccaaagactgtacgggttccatatccaaaggcagga
gctgtgaatccaactgtaaagttctttgttgtaaatacagactctctcagctcagtcacc
aatgcaacttccatacaaatcactgctcctgcttctatgttgataggggatcactacttg
tgtgatgtgacatgggcaacacaagaaagaatttctttgcagtggctcaggaggattcag
aactattcggtcatggatatttgtgactatgatgaatccagtggaagatggaactgctta
gtggcacggcaacacattgaaatgagtactactggctgggttggaagatttaggccttca
gaacctcattttacccttgatggtaatagcttctacaagatcatcagcaatgaagaaggt
tacagacacatttgctatttccaaatagataaaaaagactgcacatttattacaaaaggc
acctgggaagtcatcgggatagaagctctaaccagtgattatctatactacattagtaat
gaatataaaggaatgccaggaggaaggaatctttataaaatccaacttagtgactataca
aaagtgacatgcctcagttgtgagctgaatccggaaaggtgtcagtactattctgtgtca
ttcagtaaagaggcgaagtattatcagctgagatgttccggtcctggtctgcccctctat
actctacacagcagcgtgaatgataaagggctgagagtcctggaagacaattcagctttg
gataaaatgctgcagaatgtccagatgccctccaaaaaactggacttcattattttgaat
gaaacaaaattttggtatcagatgatcttgcctcctcattttgataaatccaagaaatat
cctctactattagatgtgtatgcaggcccatgtagtcaaaaagcagacactgtcttcaga
ctgaactgggccacttaccttgcaagcacagaaaacattatagtagctagctttgatggc
agaggaagtggttaccaaggagataagatcatgcatgcaatcaacagaagactgggaaca
tttgaagttgaagatcaaattgaagcagccagacaattttcaaaaatgggatttgtggac
aacaaacgaattgcaatttggggctggtcatatggagggtacgtaacctcaatggtcctg
ggatcgggaagtggcgtgttcaagtgtggaatagccgtggcgcctgtatcccggtgggag
tactatgactcagtgtacacagaacgttacatgggtctcccaactccagaagacaacctt
gaccattacagaaattcaacagtcatgagcagagctgaaaattttaaacaagttgagtac
ctccttattcatggaacagcagatgataacgttcactttcagcagtcagctcagatctcc
aaagccctggtcgatgttggagtggatttccaggcaatgtggtatactgatgaagaccat
ggaatagctagcagcacagcacaccaacatatatatacccacatgagccacttcataaaa
caatgtttctctttaccttag

KEGG   Homo sapiens (human): 4224
Entry
4224              CDS       T01001                                 

Gene name
MEP1A, PPHA
Definition
(RefSeq) meprin A subunit alpha
  KO
K01395  meprin A [EC:3.4.24.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    4224 (MEP1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4224 (MEP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4224 (MEP1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.18  meprin A
     4224 (MEP1A)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   4224 (MEP1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4224 (MEP1A)
SSDB
Motif
Pfam: Astacin MAM EGF EGF_CA
Other DBs
NCBI-GeneID: 4224
NCBI-ProteinID: NP_005579
OMIM: 600388
HGNC: 7015
Ensembl: ENSG00000112818
Vega: OTTHUMG00000014790
Pharos: Q16819(Tbio)
UniProt: Q16819
Position
6p12.3
AA seq 746 aa
MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDIL
LQKSRNGLRDPNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQQFDGCWSEVGDQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
DQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIG
QRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTRDDTDWAHQDSAQAGEV
DHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVV
WVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSG
YLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAIND
TVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLS
QTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVENTGP
LEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGHAFFYTGERCQAVQVHGSVLG
MVIGGTAGVIFLTFSIIAILSQRPRK
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggcttggattagatccacttgcattctcttttttaccttgctttttgcccacatagca
gctgtaccgattaagtatcttcctgaagaaaatgtacatgatgcagattttggtgaacag
aaggatatttcagaaatcaatttagctgcaggcttggacctctttcaaggggacatcctc
ttgcagaaatccagaaatggcctgagagacccaaacaccaggtggacgttccccattcct
tacatcttggctgataatttggggctgaatgctaaaggagccattctgtatgcctttgag
atgttccgtctcaagtcctgtgtggatttcaagccctatgaaggagagagctcatatatc
atatttcaacagtttgatgggtgctggtctgaggttggtgaccaacatgtgggacagaac
atttccattggccaaggatgtgcctataaggccatcatagaacacgagatcctgcatgct
ttgggattttaccacgagcagtcaaggacggaccgggatgattatgtgaacatctggtgg
gaccaaattctttcaggttaccagcacaactttgacacctatgatgatagcttaatcaca
gacctcaatacaccctatgattatgagtctttgatgcactaccagcctttctcatttaac
aagaatgcaagtgttcccaccatcacagccaagatccctgagtttaactccattatcgga
cagcgcctggatttcagtgccattgatttagagaggctgaaccgaatgtacaattgcacc
acaactcacactcttttggaccactgtacttttgagaaggcaaacatctgtggaatgatt
cagggcaccagagatgacactgactgggcccatcaggacagtgctcaggctggagaagtg
gatcacaccttgttgggacaatgcacaggtgccggctacttcatgcagttcagcaccagc
tcggggtccgcggaagaggcagccctactggagtctcggattctttacccaaagaggaag
cagcagtgcctgcaatttttctataaaatgacgggaagtccttcagacagactcgttgtc
tgggtcaggagggatgacagcacaggcaatgttcgcaagttggtgaaggtgcagactttt
caaggagatgatgaccacaattggaaaattgcccatgtggtgctcaaagaggaacagaag
tttcgctaccttttccagggcacaaaaggcgaccctcagaactcaactgggggaatttac
ctagatgacatcactctgacagaaaccccctgccccacaggggtctggacagtccggaat
ttctcccaagtccttgagaacaccagcaaaggggacaagcttcagagccctcgattctac
aattcggagggatatggttttggggtaactttatacccaaatagcagagaaagctctggt
tacttgagacttgcttttcatgtgtgcagtggggagaacgatgctatcctggagtggccg
gtagaaaacagacaggtgataattaccatccttgaccaggagcctgatgtccggaacagg
atgtcctcaagcatggtgttcactacctcgaagtcgcacacatctccagcgataaatgac
actgtcatctgggacaggccgtccagggtgggaacctatcatacggactgtaattgtttt
agaagcatcgacttgggctggagtggtttcatttcccaccaaatgctgaaaaggaggagt
ttcctgaaaaatgatgacctcatcatatttgtggactttgaagatatcacccacctcagc
cagactgaagttcccactaaaggcaaaagactgagcccccaaggcctcattctccaaggc
caggagcagcaggtctccgaagaaggttcgggaaaggccatgttagaggaagccctacct
gtcagcctgagccaggggcagcccagccgacagaagcggtcggtggagaacacaggcccc
ctggaggaccataactggccacagtacttcagagacccatgtgacccaaacccttgccaa
aatgacggcatctgtgtgaacgtgaaggggatggcgagctgcaggtgcatctctggacat
gctttcttctacacgggggagcgctgtcaggccgtgcaggtgcacggcagtgtcctgggc
atggtgatcggaggcacggctggcgtgatcttcttgaccttctccatcatcgccatcctt
tcccaaaggccaaggaagtga

KEGG   Homo sapiens (human): 4225
Entry
4225              CDS       T01001                                 

Gene name
MEP1B
Definition
(RefSeq) meprin A subunit beta
  KO
K08606  meprin B [EC:3.4.24.63]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    4225 (MEP1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4225 (MEP1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.63  meprin B
     4225 (MEP1B)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   4225 (MEP1B)
SSDB
Motif
Pfam: Astacin MAM EGF LRRC37AB_C
Other DBs
NCBI-GeneID: 4225
NCBI-ProteinID: NP_005916
OMIM: 600389
HGNC: 7020
Ensembl: ENSG00000141434
Vega: OTTHUMG00000179708
Pharos: Q16820(Tbio)
UniProt: Q16820
Structure
PDB: 
4GWM 4GWN

Position
18q12.1
AA seq 701 aa
MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
TVALFSNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
APSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggatttatggaatctgtcttggtttctgttcttggatgctcttctcgtgatttctggc
ttggcaactccagaaaactttgatgtagatggcggaatggaccaggacatatttgatatc
aatgaaggtttgggactggatctttttgagggtgacatcagacttgatagggcacaaatt
agaaattccatcattggagaaaagtatagatggcctcataccattccatatgttctagaa
gatagcttggaaatgaatgctaagggagttatcctcaatgcatttgaacgttatcgcctt
aaaacatgtattgactttaagccttgggctggagaaacaaactatatatcagtgttcaag
ggcagtggctgctggtcttcagtaggaaataggcgggttgggaagcaagaactttccatc
ggggcaaactgtgaccgaatagcaacagttcaacacgagttcctccacgctctgggattc
tggcatgagcagtcgcgttctgaccgggatgactatgtcaggataatgtgggacagaatt
ctgtcaggcagagagcacaattttaacacctatagtgacgatatatcagattccctgaat
gttccctatgattacacttcagtaatgcactacagtaaaactgcattccaaaatggaaca
gagccgacaattgtcacaagaatctcagactttgaggatgtgatcggccaacgaatggat
ttcagtgactctgatctcctaaagttgaatcaactgtataactgctcctcttccttgagt
tttatggactcgtgcagttttgaactggaaaatgtgtgtggcatgatccaaagttcagga
gataatgctgactggcaacgggtttcacaggttcccagggggccagagagtgatcactcc
aacatgggccagtgccaaggttctggtttcttcatgcatttcgatagcagctctgtaaat
gtgggggccacagcagtgctggaaagtagaacgctgtaccctaaaagaggatttcagtgc
ctgcaattttacttatataacagtggcagtgaaagtgatcaactgaacatctatatcagg
gagtattctgcagacaatgtggatggcaatttaacccttgtggaagaaataaaagaaata
cccactgggagctggcaactttatcatgtaacattgaaagtgaccaagaagtttagagtg
gtgtttgaaggacgcaaaggctctggtgcatcactgggtggtctgtctattgatgacatc
aatctttcggaaacacggtgccctcatcatatctggcatataaggaatttcacacagttc
attggcagcccaaatggaactctgtatagccctccattttactcttctaaaggttatgcc
tttcagatttacttaaatctagcccatgtgactaatgcagggatatatttccacttgatc
tctggagccaatgatgatcaattacagtggccatgtccttggcaacaagccacaatgaca
cttttggatcaaaatcctgacattcgacagcgtatgtccaatcagcggagtataactaca
gacccatttatgaccaccgataatggaaactatttctgggacaggccttctaaagtggga
acagtggctttgttctctaatggaactcagtttagaagaggtgggggctatggaaccagt
gcctttataacccacgaaaggctgaaaagcagagattttataaaaggagatgatgtttat
atcctactgacagtggaagacatatctcacctcaactctacacaaatccagctaacacca
gcccctagtgttcaagacctctgctcaaaaaccacctgtaaaaatgacggtgtctgcact
gttcgagatggcaaagctgagtgcaggtgccagtcaggggaagactggtggtacatggga
gaaaggtgtgaaaagagaggctccacccgagacaccatagtcattgctgtttcatctact
gttgctgtgtttgccttgatgctgatcatcacccttgtcagtgtctattgcaccaggaag
aaatatcgtgaaaggatgagctcaaatcgaccaaatttgactccgcaaaatcagcatgct
ttttga

KEGG   Homo sapiens (human): 4311
Entry
4311              CDS       T01001                                 

Gene name
MME, CALLA, CD10, CMT2T, NEP, SCA43, SFE
Definition
(RefSeq) membrane metalloendopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04640  Hematopoietic cell lineage
hsa04974  Protein digestion and absorption
hsa05010  Alzheimer disease
Disease
H00063  Spinocerebellar ataxia (SCA)
H00264  Charcot-Marie-Tooth disease
Drug target
Candoxatril: D01070
Candoxatrilat: D03349
Ecadotril: D03929
Omapatrilat: D01970
Racecadotril: D08464
Sacubitril: D10225
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    4311 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    4311 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    4311 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4311 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4311 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4311 (MME)
   04090 CD molecules [BR:hsa04090]
    4311 (MME)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     4311 (MME)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M13: neprilysin family
   4311 (MME)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4311 (MME)
CD molecules [BR:hsa04090]
 Proteins
  4311 (MME)
SSDB
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Other DBs
NCBI-GeneID: 4311
NCBI-ProteinID: NP_000893
OMIM: 120520
HGNC: 7154
Ensembl: ENSG00000196549
Vega: OTTHUMG00000158455
Pharos: P08473(Tclin)
UniProt: P08473
Structure
PDB: 

Position
3q25.2
AA seq 750 aa
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgggcaagtcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggactccactggagatcagcctctcggtccttgtcctgctcctcaccatc
atagctgtgacaatgatcgcactctatgcaacctacgatgatggtatttgcaagtcatca
gactgcataaaatcagctgctcgactgatccaaaacatggatgccaccactgagccttgt
acagactttttcaaatatgcttgcggaggctggttgaaacgtaatgtcattcccgagacc
agctcccgttacggcaactttgacattttaagagatgaactagaagtcgttttgaaagat
gtccttcaagaacccaaaactgaagatatagtagcagtgcagaaagcaaaagcattgtac
aggtcttgtataaatgaatctgctattgatagcagaggtggagaacctctactcaaactg
ttaccagacatatatgggtggccagtagcaacagaaaactgggagcaaaaatatggtgct
tcttggacagctgaaaaagctattgcacaactgaattctaaatatgggaaaaaagtcctt
attaatttgtttgttggcactgatgataagaattctgtgaatcatgtaattcatattgac
caacctcgacttggcctcccttctagagattactatgaatgcactggaatctataaagag
gcttgtacagcatatgtggattttatgatttctgtggccagattgattcgtcaggaagaa
agattgcccatcgatgaaaaccagcttgctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacggctaaacctgaagatcgaaatgatccaatgcttctgtat
aacaagatgacattggcccagatccaaaataacttttcactagagatcaatgggaagcca
ttcagctggttgaatttcacaaatgaaatcatgtcaactgtgaatattagtattacaaat
gaggaagatgtggttgtttatgctccagaatatttaaccaaacttaagcccattcttacc
aaatattctgccagagatcttcaaaatttaatgtcctggagattcataatggatcttgta
agcagcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctttatggt
acaacctcagaaacagcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgctgtggggaggctttatgtggaagcagcatttgctggagagagtaaacatgtggtc
gaggatttgattgcacagatccgagaagtttttattcagactttagatgacctcacttgg
atggatgccgagacaaaaaagagagctgaagaaaaggccttagcaattaaagaaaggatc
ggctatcctgatgacattgtttcaaatgataacaaactgaataatgagtacctcgagttg
aactacaaagaagatgaatacttcgagaacataattcaaaatttgaaattcagccaaagt
aaacaactgaagaagctccgagaaaaggtggacaaagatgagtggataagtggagcagct
gtagtcaatgcattttactcttcaggaagaaatcagatagtcttcccagccggcattctg
cagccccccttctttagtgcccagcagtccaactcattgaactatgggggcatcggcatg
gtcataggacacgaaatcacccatggcttcgatgacaatggcagaaactttaacaaagat
ggagacctcgttgactggtggactcaacagtctgcaagtaactttaaggagcaatcccag
tgcatggtgtatcagtatggaaacttttcctgggacctggcaggtggacagcaccttaat
ggaattaatacactgggagaaaacattgctgataatggaggtcttggtcaagcatacaga
gcctatcagaattatattaaaaagaatggcgaagaaaaattacttcctggacttgaccta
aatcacaaacaactatttttcttgaactttgcacaggtgtggtgtggaacctataggcca
gagtatgcggttaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctgcagagttttcagaagcctttcactgccgcaagaattcatac
atgaatccagaaaagaagtgccgggtttggtga

KEGG   Homo sapiens (human): 5547
Entry
5547              CDS       T01001                                 

Gene name
PRCP, HUMPCP, PCP
Definition
(RefSeq) prolylcarboxypeptidase
  KO
K01285  lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    5547 (PRCP)
  09154 Digestive system
   04974 Protein digestion and absorption
    5547 (PRCP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5547 (PRCP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     5547 (PRCP)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S28
   5547 (PRCP)
SSDB
Motif
Pfam: Peptidase_S28 Hydrolase_4 Peptidase_S37 DUF2920 Peptidase_S9 Abhydrolase_6 Abhydrolase_1
Other DBs
NCBI-GeneID: 5547
NCBI-ProteinID: NP_005031
OMIM: 176785
HGNC: 9344
Ensembl: ENSG00000137509
Vega: OTTHUMG00000166899
Pharos: P42785(Tchem)
UniProt: P42785 A0A024R5L0
Structure
PDB: 
3N2Z

Position
11q14.1
AA seq 496 aa
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgggccgccgagccctcctgctcctgcttctgtcttttctggcgccctgggccaccata
gccctccggccggccttaagggccctcggcagcctacacttgccaaccaaccccacatcc
ctcccggctgtagccaagaactattcggttctctacttccaacagaaggttgatcatttt
ggatttaatactgtgaaaacttttaatcagcggtacctagtagctgataaatactggaag
aaaaatggtggatcaatacttttctacactggtaatgaaggggacattatctggttttgt
aataacacggggttcatgtgggatgtggctgaggaactgaaagctatgttggtgtttgct
gaacatcgatactatggagagtctctcccctttggtgacaactcattcaaggattccaga
cacttgaatttcctgacatcagaacaagctctggctgattttgcagagttaatcaaacac
ttgaaaagaacaatcccaggagctgaaaatcaacctgtcattgccataggaggctcctat
ggtggcatgcttgccgcctggtttaggatgaaatatcctcatatggtagttggagctctt
gcagcttctgcccctatctggcagtttgaggatttagtaccttgtggtgtatttatgaag
atcgtaactacagattttaggaaaagcggtccacattgttcagagagcatccacaggtcc
tgggatgccattaatcgactctcaaatactggcagtggtttgcagtggcttactggagcc
cttcacttatgcagcccattaacttctcaggacatccaacatttgaaagactggatctct
gaaacctgggtgaatctggcaatggtggactatccttatgcctctaactttttacagcct
ttgcctgcttggcctatcaaggtagtgtgccagtatttgaaaaatcccaatgtatctgat
tcactgctgctgcagaatattttccaagctctgaatgtatattacaattattcgggccag
gtgaaatgcctgaatatttcagagacagcaactagcagtctgggaacactgggttggagc
tatcaggcctgcacagaagtagtcatgcccttttgtactaatggtgtcgatgacatgttt
gaacctcactcatggaacttaaaggaactttctgatgactgttttcaacagtggggtgtg
agaccaaggccctcctggatcactactatgtatggaggcaaaaacattagttcacacaca
aacattgttttcagcaatggtgaactagacccctggtcaggaggtggagtaactaaggat
atcacagacactctggttgcagtcaccatctcagagggggcccaccacttagatctccgc
accaagaatgccttggatcctatgtctgtgctgttagcccgctccttggaagttagacat
atgaagaattggatcagagatttctatgacagtgcgggaaagcagcactga

KEGG   Homo sapiens (human): 59272
Entry
59272             CDS       T01001                                 

Gene name
ACE2, ACEH
Definition
(RefSeq) angiotensin I converting enzyme 2
  KO
K09708  angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04974  Protein digestion and absorption
hsa05171  Coronavirus disease - COVID-19
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    59272 (ACE2)
  09154 Digestive system
   04974 Protein digestion and absorption
    59272 (ACE2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    59272 (ACE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    59272 (ACE2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    59272 (ACE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     59272 (ACE2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M2
   59272 (ACE2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   59272 (ACE2)
SSDB
Motif
Pfam: Peptidase_M2 Collectrin
Other DBs
NCBI-GeneID: 59272
NCBI-ProteinID: NP_068576
OMIM: 300335
HGNC: 13557
Ensembl: ENSG00000130234
Vega: OTTHUMG00000021177
Pharos: Q9BYF1(Tchem)
UniProt: Q9BYF1
Structure
PDB: 

Position
Xp22.2
AA seq 805 aa
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgtcaagctcttcctggctccttctcagccttgttgctgtaactgctgctcagtccacc
attgaggaacaggccaagacatttttggacaagtttaaccacgaagccgaagacctgttc
tatcaaagttcacttgcttcttggaattataacaccaatattactgaagagaatgtccaa
aacatgaataatgctggggacaaatggtctgcctttttaaaggaacagtccacacttgcc
caaatgtatccactacaagaaattcagaatctcacagtcaagcttcagctgcaggctctt
cagcaaaatgggtcttcagtgctctcagaagacaagagcaaacggttgaacacaattcta
aatacaatgagcaccatctacagtactggaaaagtttgtaacccagataatccacaagaa
tgcttattacttgaaccaggtttgaatgaaataatggcaaacagtttagactacaatgag
aggctctgggcttgggaaagctggagatctgaggtcggcaagcagctgaggccattatat
gaagagtatgtggtcttgaaaaatgagatggcaagagcaaatcattatgaggactatggg
gattattggagaggagactatgaagtaaatggggtagatggctatgactacagccgcggc
cagttgattgaagatgtggaacatacctttgaagagattaaaccattatatgaacatctt
catgcctatgtgagggcaaagttgatgaatgcctatccttcctatatcagtccaattgga
tgcctccctgctcatttgcttggtgatatgtggggtagattttggacaaatctgtactct
ttgacagttccctttggacagaaaccaaacatagatgttactgatgcaatggtggaccag
gcctgggatgcacagagaatattcaaggaggccgagaagttctttgtatctgttggtctt
cctaatatgactcaaggattctgggaaaattccatgctaacggacccaggaaatgttcag
aaagcagtctgccatcccacagcttgggacctggggaagggcgacttcaggatccttatg
tgcacaaaggtgacaatggacgacttcctgacagctcatcatgagatggggcatatccag
tatgatatggcatatgctgcacaaccttttctgctaagaaatggagctaatgaaggattc
catgaagctgttggggaaatcatgtcactttctgcagccacacctaagcatttaaaatcc
attggtcttctgtcacccgattttcaagaagacaatgaaacagaaataaacttcctgctc
aaacaagcactcacgattgttgggactctgccatttacttacatgttagagaagtggagg
tggatggtctttaaaggggaaattcccaaagaccagtggatgaaaaagtggtgggagatg
aagcgagagatagttggggtggtggaacctgtgccccatgatgaaacatactgtgacccc
gcatctctgttccatgtttctaatgattactcattcattcgatattacacaaggaccctt
taccaattccagtttcaagaagcactttgtcaagcagctaaacatgaaggccctctgcac
aaatgtgacatctcaaactctacagaagctggacagaaactgttcaatatgctgaggctt
ggaaaatcagaaccctggaccctagcattggaaaatgttgtaggagcaaagaacatgaat
gtaaggccactgctcaactactttgagcccttatttacctggctgaaagaccagaacaag
aattcttttgtgggatggagtaccgactggagtccatatgcagaccaaagcatcaaagtg
aggataagcctaaaatcagctcttggagataaagcatatgaatggaacgacaatgaaatg
tacctgttccgatcatctgttgcatatgctatgaggcagtactttttaaaagtaaaaaat
cagatgattctttttggggaggaggatgtgcgagtggctaatttgaaaccaagaatctcc
tttaatttctttgtcactgcacctaaaaatgtgtctgatatcattcctagaactgaagtt
gaaaaggccatcaggatgtcccggagccgtatcaatgatgctttccgtctgaatgacaac
agcctagagtttctggggatacagccaacacttggacctcctaaccagccccctgtttcc
atatggctgattgtttttggagttgtgatgggagtgatagtggttggcattgtcatcctg
atcttcactgggatcagagatcggaagaagaaaaataaagcaagaagtggagaaaatcct
tatgcctccatcgatattagcaaaggagaaaataatccaggattccaaaacactgatgat
gttcagacctccttttag

KEGG   Homo sapiens (human): 7512
Entry
7512              CDS       T01001                                 

Gene name
XPNPEP2, AEACEI, APP2
Definition
(RefSeq) X-prolyl aminopeptidase 2
  KO
K14208  Xaa-Pro aminopeptidase 2 [EC:3.4.11.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    7512 (XPNPEP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7512 (XPNPEP2)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    7512 (XPNPEP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     7512 (XPNPEP2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M24
   7512 (XPNPEP2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  7512 (XPNPEP2)
SSDB
Motif
Pfam: Creatinase_N_2 Peptidase_M24 Peptidase_M24_C Creatinase_N
Other DBs
NCBI-GeneID: 7512
NCBI-ProteinID: NP_003390
OMIM: 300145
HGNC: 12823
Ensembl: ENSG00000122121
Vega: OTTHUMG00000022373
Pharos: O43895(Tchem)
UniProt: O43895
Position
Xq26.1
AA seq 674 aa
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQ
MQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQ
AERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQL
VSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
ALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCV
QIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSK
EQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETIS
ASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYT
RVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQ
SNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNL
IDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWAS
VLVVSTLAILGWSV
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggcccgggctcactggggctgctgcccctggctggtcctcctctgtgcttgtgcctgg
ggccacacaaagccagtggaccttggagggcaggatgtgagaaactgttccaccaacccc
ccttaccttccagttactgtggtcaataccacaatgtcactcacagccctccgccagcag
atgcagacccagaatctctcagcctacatcatcccaggcacagatgctcacatgaacgag
tacatcggccaacatgacgagaggcgtgcgtggattacaggctttacagggtctgcagga
actgcagtggtgactatgaagaaagcagctgtctggaccgacagtcgctactggactcag
gctgagcggcagatggactgcaactgggagctccataaggaagttggcaccactcctatt
gtcacctggctcctcaccgagattcctgctggagggcgtgtgggttttgaccccttcctc
ttgtccattgacacctgggagagttatgatctggccctccaaggctctaacagacagctg
gtgtccatcacaaccaatcttgtggacctggtatggggatcagagaggccaccggttcca
aatcaacccatttatgccctgcaggaggcattcacagggagcacttggcaggagaaagta
tctggcgtccgaagccagatgcagaagcatcaaaaggtcccgactgccgtccttctgtcg
gcgcttgaggagacggcctggctcttcaaccttcgagccagtgacatcccctataacccc
ttcttctattcctacacgctgctcacagactcttctattaggttgtttgcaaacaagagt
cgctttagctccgaaaccttgagctatctgaactccagttgcacaggccccatgtgtgtg
caaatcgaggattacagccaagttcgtgacagcatccaggcctactcattgggagatgtg
aggatctggattgggaccagctataccatgtatgggatctatgaaatgatacccaaggag
aaactcgtgacagacacctactccccagtgatgatgaccaaggcagtgaagaacagcaag
gagcaggccctcctcaaggccagccacgtgcgggacgctgtggctgtgatccggtacttg
gtctggctggagaagaacgtgcccaaaggcacagtggatgagttctcgggggcagagatc
gtggacaagttccgaggagaagaacagttctcctccggacccagttttgaaaccatctct
gctagtggtctgaatgctgccctggcccactacagcccgaccaaggagctgaaccgcaag
ctgtcctcagatgagatgtacctgctggactctggggggcagtactgggacgggaccaca
gacatcaccagaacagtccactggggcaccccctctgccttccagaaggaggcatacacc
cgtgtgctgataggaaatattgacctgtccaggctcatctttcccgctgctacatcaggg
cgaatggtggaggcctttgcccgcagagccttgtgggatgctggtctcaattatggtcat
gggacaggccacggcattggcaacttcctgtgtgtgcatgagtggccagtgggattccag
tccaacaacatcgctatggccaagggcatgttcacttccattgaacctggttactataag
gatggagaatttgggatccgtctcgaagatgtggctctcgtggtagaagcaaagaccaag
tacccagggagctacctgacctttgaagtggtatcatttgtgccctatgaccggaacctc
atcgatgtcagcctgctgtctcccgagcatctccagtacctgaatcgctactaccagacc
atccgggagaaggtgggtccagagctgcagaggcgccagctactagaggagttcgagtgg
cttcaacagcacacagagcccctggccgccagggccccagacaccgcctcctgggcctct
gtgttagtggtctccacccttgccatccttggctggagtgtctag

DBGET integrated database retrieval system