KEGG   Homo sapiens (human): 181Help
Entry
181               CDS       T01001                                 

Gene name
AGRP, AGRT, ART, ASIP2
Definition
(RefSeq) agouti related neuropeptide
  KO
K05231  agouti related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04920  Adipocytokine signaling pathway
Disease
H01703  Eating Disorders
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    181 (AGRP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Agouti
Motif
Other DBs
NCBI-GeneID: 181
NCBI-ProteinID: NP_001129
OMIM: 602311
HGNC: 330
Ensembl: ENSG00000159723
Vega: OTTHUMG00000137509
Pharos: O00253(Tbio)
UniProt: O00253 C6SUN5
Position
16q22.1
AA seq 132 aa AA seqDB search
MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTAMNPCSRT
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgcagcggtgctgagctgtgccctgctgctggcactgcctgccacgcgagga
gcccagatgggcttggcccccatggagggcatcagaaggcctgaccaggccctgctccca
gagctcccaggcctgggcctgcgggccccactgaagaagacaactgcagaacaggcagaa
gaggatctgttgcaggaggctcaggccttggcagaggtactagacctgcaggaccgcgag
ccccgctcctcacgtcgctgcgtaaggctgcatgagtcctgcctgggacagcaggtgcct
tgctgtgacccatgtgccacgtgctactgccgcttcttcaatgccttctgctactgccgc
aagctgggtactgccatgaatccctgcagccgcacctag

DBGET integrated database retrieval system