KEGG   Homo sapiens (human): 1814Help
Entry
1814              CDS       T01001                                 

Gene name
DRD3, D3DR, ETM1, FET1
Definition
(RefSeq) dopamine receptor D3
  KO
K04146  dopamine receptor D3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01649  Schizophrenia
Drug target
Amisulpride: D07310
Aplindore fumarate: D03214
Aripiprazole (DG00906): D01164 D10355 D10364 D10516
Blonanserin: D01176
Captodiame: D07316
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Etilevodopa: D04097
Levodopa: D00059
Lisuride (DG00453): D01462 D08132
Mosapramine (DG00905): D01548 D08235
Olanzapine (DG00898): D00454 D06623
Oxiperomide: D02676
Pardoprunox (DG01324): D09366 D09397
Pimozide: D00560
Piribedil: D07305
Pramipexole (DG00863): D00559 D05575
Quinpirole hydrochloride: D05682
Ropinirole (DG00862): D00784 D08489
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1814 (DRD3)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1814 (DRD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1814 (DRD3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1814 (DRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 1814
NCBI-ProteinID: NP_000787
OMIM: 126451
HGNC: 3024
Ensembl: ENSG00000151577
Vega: OTTHUMG00000159334
Pharos: P35462(Tclin)
UniProt: P35462 X5D2G4 A8K8E4
Position
3q13.31
AA seq 400 aa AA seqDB search
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctgagccagctgagtggccacctgaactacacctgtggggcagagaactcc
acaggtgccagccaggcccgcccacatgcctactatgccctctcctactgcgcgctcatc
ctggccatcgtcttcggcaatggcctggtgtgcatggctgtgctgaaggagcgggccctg
cagactaccaccaactacttagtagtgagcctggctgtggcagacttgctggtggccacc
ttggtgatgccctgggtggtatacctggaggtgacaggtggagtctggaatttcagccgc
atttgctgtgatgtttttgtcaccctggatgtcatgatgtgtacagccagcatccttaat
ctctgtgccatcagcatagacaggtacactgcagtggtcatgcccgttcactaccagcat
ggcacgggacagagctcctgtcggcgcgtggccctcatgatcacggccgtctgggtactg
gcctttgctgtgtcctgccctcttctgtttggctttaataccacaggggaccccactgtc
tgctccatctccaaccctgattttgtcatctactcttcagtggtgtccttctacctgccc
tttggagtgactgtccttgtctatgccagaatctatgtggtgctgaaacaaaggagacgg
aaaaggatcctcactcgacagaacagtcagtgcaacagtgtcaggcctggcttcccccaa
caaaccctctctcctgacccggcacatctggagctgaagcgttactacagcatctgccag
gacactgccttgggtggaccaggcttccaagaaagaggaggagagttgaaaagagaggag
aagactcggaattccctgagtcccaccatagcgcccaagctcagcttagaagttcgaaaa
ctcagcaatggcagattatcgacatctttgaagctggggcccctgcaacctcggggagtg
ccacttcgggagaagaaggcaacccaaatggtggccattgtgcttggggccttcattgtc
tgctggctgcccttcttcttgacccatgttctcaatacccactgccagacatgccacgtg
tccccagagctttacagtgccacgacatggctgggctacgtgaatagcgccctcaaccct
gtgatctataccaccttcaatatcgagttccggaaagccttcctcaagatcctgtcttgc
tga

DBGET integrated database retrieval system