KEGG   Homo sapiens (human): 1815Help
Entry
1815              CDS       T01001                                 

Gene name
DRD4, D4DR
Definition
(RefSeq) dopamine receptor D4
  KO
K04147  dopamine receptor D4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01450  Obsessive-compulsive disorder (OCD)
H01671  Neurosis
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Clozapine: D00283
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Fananserin: D02656
Levodopa: D00059
Lisuride (DG00453): D01462 D08132
Mosapramine (DG00905): D01548 D08235
Olanzapine (DG00898): D00454 D06623
Oxiperomide: D02676
Pramipexole (DG00863): D00559 D05575
Ropinirole (DG00862): D00784 D08489
Sonepiprazole mesylate: D05891
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1815 (DRD4)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1815 (DRD4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1815 (DRD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1815
NCBI-ProteinID: NP_000788
OMIM: 126452
HGNC: 3025
Ensembl: ENSG00000069696
Vega: OTTHUMG00000133312
Pharos: P21917(Tchem)
UniProt: P21917 A0A0G2JM26
Position
11p15.5
AA seq 419 aa AA seqDB search
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgcagcaccgcggacgcggacgggctgctggctgggcgcgggccggccgcg
ggggcatctgcgggggcatctgcggggctggctgggcagggcgcggcggcgctggtgggg
ggcgtgctgctcatcggcgcggtgctcgcggggaactcgctcgtgtgcgtgagcgtggcc
accgagcgcgccctgcagacgcccaccaactccttcatcgtgagcctggcggccgccgac
ctcctcctcgctctcctggtgctgccgctcttcgtctactccgaggtccagggtggcgcg
tggctgctgagcccccgcctgtgcgacgccctcatggccatggacgtcatgctgtgcacc
gcctccatcttcaacctgtgcgccatcagcgtggacaggttcgtggccgtggccgtgccg
ctgcgctacaaccggcagggtgggagccgccggcagctgctgctcatcggcgccacgtgg
ctgctgtccgcggcggtggcggcgcccgtactgtgcggcctcaacgacgtgcgcggccgc
gaccccgccgtgtgccgcctggaggaccgcgactacgtggtctactcgtccgtgtgctcc
ttcttcctaccctgcccgctcatgctgctgctctactgggccacgttccgcggcctgcag
cgctgggaggtggcacgtcgcgccaagctgcacggccgcgcgccccgccgacccagcggc
cctggcccgccttcccccacgccacccgcgccccgcctcccccaggacccctgcggcccc
gactgtgcgccccccgcgcccggccttccccggggtccctgcggccccgactgtgcgccc
gccgcgcccagcctcccccaggacccctgcggccccgactgtgcgccccccgcgcccggc
ctccccccggacccctgcggctccaactgtgctccccccgacgccgtcagagccgccgcg
ctcccaccccagactccaccgcagacccgcaggaggcggcgtgccaagatcaccggccgg
gagcgcaaggccatgagggtcctgccggtggtggtcggggccttcctgctgtgctggacg
cccttcttcgtggtgcacatcacgcaggcgctgtgtcctgcctgctccgtgcccccgcgg
ctggtcagcgccgtcacctggctgggctacgtcaacagcgccctcaaccccgtcatctac
actgtcttcaacgccgagttccgcaacgtcttccgcaaggccctgcgtgcctgctgctga

DBGET integrated database retrieval system